SecReT4
Protein ID: 103487956
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2477
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2615962..2617143 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ1GQ88
KEGG IDsal:Sala_2477
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.4e-57, Aligned region: 208..385
Protein Sequence: 393 a.a.     [Download]
>gi|103487956|ref|YP_617517.1| conjugation TrbI-like protein [Sphingopyxis alaskensis RB2256]
MELVAVPPASGEPFRLGAEPPSVMRLSRKALAILGAALGTAIGGALLYALQPAKLKVAENLYDSDRANKS
ELVTGAPGDYGKIPKLGEPLPGDLGRPILAARENGETVPVPPIGAPPPPDPRAAAAEQARARAAQERESA
RASQLFLGGGASVTSQLPVLGEGVLRPAPDNLQANPTAADKRKGFLSGDGAGPAESMARLVQPSSPHLVQ
AGSVIPAALITGIRSDLPGQITAQVTQNVYDSPTGRILLIPQGARLIGEYGSEIADGQSRVLLAWDRLIL
PGGRSIALDRLPGADAAGMAGLADRTDYHWGHMLKATLVSTLLGVGAELGADDEDRLVRAVRRGAQDSIN
ETGRQLVERQLGVKPTITVRSGAILRVIVTRDIILEPLDRGGR
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2617143-2615962 Sphingopyxis alaskensis RB2256 chromosome, complete genome
GTGGAACTCGTCGCTGTCCCTCCCGCAAGCGGCGAGCCCTTTCGGCTTGGTGCCGAGCCGCCGAGCGTCA
TGCGCCTGTCGCGCAAGGCGCTGGCCATTCTAGGCGCCGCATTGGGGACCGCTATCGGCGGCGCGCTTCT
CTATGCGCTGCAGCCCGCCAAGCTCAAGGTGGCCGAGAATCTCTACGATAGCGACCGTGCGAACAAGTCC
GAGCTCGTGACCGGAGCGCCGGGCGATTATGGCAAGATCCCGAAGCTCGGCGAGCCGCTCCCTGGCGATC
TCGGGCGGCCGATCCTTGCCGCGCGCGAGAATGGCGAGACCGTCCCGGTGCCTCCGATCGGCGCGCCTCC
GCCGCCAGACCCGCGAGCCGCTGCGGCGGAGCAAGCCCGCGCGCGTGCGGCCCAGGAACGCGAAAGCGCG
CGCGCCAGCCAGCTCTTCCTCGGCGGTGGGGCGTCGGTCACCTCGCAGCTGCCGGTGCTTGGCGAAGGCG
TGTTGCGACCGGCGCCCGACAATCTGCAAGCCAACCCGACCGCGGCCGACAAGCGCAAGGGCTTCCTCAG
TGGTGATGGCGCCGGTCCGGCAGAGAGCATGGCGCGGCTCGTCCAGCCCTCATCGCCGCATCTGGTCCAG
GCGGGCAGCGTGATTCCGGCGGCACTCATCACCGGCATCCGGTCCGACTTGCCGGGCCAGATCACCGCGC
AGGTGACCCAGAATGTTTACGACAGCCCCACCGGGCGCATCCTGCTCATTCCGCAGGGTGCTCGGCTGAT
CGGCGAATATGGCAGCGAGATCGCCGACGGGCAGAGCCGGGTCCTTCTCGCATGGGACCGGCTGATCCTG
CCGGGCGGGCGCTCGATTGCTCTCGATCGCCTGCCGGGCGCCGATGCGGCCGGCATGGCCGGGCTTGCCG
ACCGGACCGATTATCATTGGGGCCATATGCTGAAGGCCACGCTGGTTTCGACGCTGCTGGGCGTCGGCGC
CGAACTCGGCGCCGACGACGAGGATCGCCTCGTTCGGGCGGTGCGGCGTGGCGCGCAGGACAGCATCAAC
GAGACGGGACGGCAACTCGTCGAACGCCAGCTTGGAGTGAAGCCGACCATCACGGTTCGGTCAGGCGCGA
TCCTCCGCGTCATTGTGACGCGGGACATCATCCTCGAGCCTCTGGATCGAGGCGGACGGTGA
 Primer design