SecReT4
Protein ID: 103487957
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2478
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2617173..2618024 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ1GQ87
KEGG IDsal:Sala_2478
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.6e-65, Aligned region: 52..274
Protein Sequence: 283 a.a.     [Download]
>gi|103487957|ref|YP_617518.1| conjugal transfer protein TrbG/VirB9/CagX [Sphingopyxis alaskensis RB2256]
MKAFSRISLLAGVAALGVASPSLGAEGRDPKQNVGRANDAARVQPDRATFLNAIQKYAWAEGALYQVYAS
PGQVTDIVLQEGEELVGPGPVAAGDTVRWIIGDTVSGSGASRRVHILVKPTRADIMTNIVINTSRRTYHI
ELRATPATYMASVSWSYPEAELIALRAAEVERERAAPVAAGLDLGALNFRYRLSGDKPDWRPVRVFDDGR
QLFIEFGEGVATGDMPPLFAVGEKGEAELVNYRVHGRFMIADRLFERGQLRMGAGRAAREVVIERVGRVR
GRS
 
Nucleotide Sequence: 852 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2618024-2617173 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAAGGCCTTTTCCCGTATCTCGCTGCTCGCGGGTGTCGCTGCGCTCGGCGTGGCGTCGCCATCCCTCG
GGGCTGAAGGTCGCGATCCGAAACAGAATGTCGGGCGCGCCAACGACGCGGCGCGCGTGCAGCCCGATCG
CGCGACCTTCCTCAACGCGATCCAGAAATATGCCTGGGCCGAGGGCGCGCTGTATCAGGTCTATGCGTCG
CCGGGGCAGGTCACTGACATCGTGCTGCAGGAGGGCGAGGAGCTTGTCGGCCCGGGGCCGGTGGCTGCCG
GCGACACGGTCCGCTGGATCATCGGCGACACGGTGAGCGGCAGCGGAGCGAGTCGCCGCGTGCACATCCT
CGTGAAGCCAACGCGGGCCGACATCATGACGAATATCGTCATCAACACGAGCCGCCGGACCTATCACATC
GAGCTGCGCGCGACGCCCGCGACCTATATGGCGTCGGTGTCCTGGTCCTATCCGGAAGCCGAGCTGATCG
CGCTGCGTGCTGCGGAGGTGGAGCGTGAGCGGGCGGCGCCGGTCGCGGCAGGGCTCGACCTTGGCGCCCT
CAACTTTCGTTACCGGCTGTCGGGCGACAAGCCGGATTGGCGACCGGTGCGCGTTTTCGATGACGGGCGC
CAGCTCTTCATCGAGTTCGGCGAAGGCGTCGCAACGGGCGATATGCCCCCGCTGTTCGCGGTCGGTGAAA
AGGGCGAGGCCGAGCTCGTCAACTACCGCGTCCATGGCCGCTTCATGATCGCCGATCGCCTGTTCGAACG
CGGACAGCTTCGGATGGGTGCCGGACGCGCGGCGCGCGAGGTGGTTATCGAGCGCGTCGGCCGCGTGCGG
GGGCGCTCGTGA
 Primer design