SecReT4
Protein ID: 103487958
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2479
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2618021..2618704 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ1GQ86
KEGG IDsal:Sala_2479
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-57, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|103487958|ref|YP_617519.1| conjugal transfer protein TrbF [Sphingopyxis alaskensis RB2256]
MFKRPTNHYGRAPEPVTPYQRAAQVWDDRIGSARVQAKNWRLAFFGSLLLSGGLAGGLIWHSARGTITPW
VVEVDKLGEARAVAPADEDYQPTDPQTAFHLARFIEHVRSVPADPVVLRKDWLRAYDFTTAAGAQALNDH
ARNNDPFSEVGKVQVAVDVSSVIRASKDSFRIAWTERRYQDGSLIETSRWSAILTVTHVPPRTPDALRRN
PLGVFVSAISWSKELSQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2618704-2618021 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGTTCAAGAGACCGACCAACCATTATGGCCGCGCCCCCGAGCCGGTCACCCCCTATCAGCGCGCCGCGC
AGGTCTGGGACGACCGTATCGGCTCGGCGCGCGTCCAGGCGAAGAACTGGCGGCTCGCCTTCTTCGGCTC
GCTCCTCCTTTCGGGCGGTCTTGCGGGGGGCCTCATCTGGCACTCGGCGCGCGGCACCATCACCCCTTGG
GTGGTCGAGGTCGACAAGCTCGGCGAGGCCCGTGCAGTCGCGCCGGCGGACGAGGATTATCAGCCGACCG
ATCCGCAGACGGCGTTCCATCTCGCGCGGTTCATCGAGCATGTGCGTTCGGTCCCGGCCGACCCGGTGGT
GCTGCGCAAGGACTGGCTCCGCGCCTATGATTTCACGACCGCGGCAGGGGCTCAGGCGCTCAACGATCAT
GCCCGCAACAACGACCCCTTTTCCGAGGTCGGCAAGGTCCAGGTCGCGGTCGACGTCTCGAGCGTGATCC
GCGCCTCGAAGGACAGCTTCCGCATCGCCTGGACCGAGCGTCGCTATCAGGACGGCAGCCTGATCGAGAC
GTCGCGCTGGTCGGCCATTCTTACCGTCACCCATGTGCCGCCGCGCACTCCCGATGCCCTCCGCCGCAAT
CCGCTTGGAGTGTTTGTTTCCGCTATTTCCTGGTCGAAGGAGCTCAGCCAATGA
 Primer design