SecReT4
Protein ID: 103487959
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2480
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2618711..2619991 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1GQ85
KEGG IDsal:Sala_2480
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4e-48, Aligned region: 37..262
Protein Sequence: 426 a.a.     [Download]
>gi|103487959|ref|YP_617520.1| conjugal transfer protein TrbL [Sphingopyxis alaskensis RB2256]
MNDTGVIDQFLSVFSTYIDSGFGLLGGEVGFLSSTLIVIDVTIAALFWAWGADEDVLQRLVKKTLYIGVF
AFIIGNFQSLATIMLESFAGLGLKASGGAMAIGDFMRPGVVAATGLDAAEPLLDASADLLGPVGLFTNFV
QIMILLVAWVIVVLAFFILAVQVFVTILEFKLVTLAGFVLIPFAFFGRTAFMAERVLGHIISSGIKVLVL
AVITGIGTTLFDRFLEAGIGPEPDIEQAMAIALGALTLLGLGIFGPSIANGIVAGGPQLGAGAAAGTTVA
AGATLAAGAAGATLAGGAAATAARGAAAAGARGAGSASAAYSAGAAGKSGARAVGSGLANVARSAASGAS
SPLRRAAEKLRANFEAGRDGPADSAAPARPADAPPAWAAAMRRRQMVTQGATIGAQTLKGGDSHGGGSAP
DISEKD
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2619991-2618711 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAACGATACGGGCGTCATCGACCAATTCCTGTCGGTCTTCTCGACCTATATCGATAGCGGCTTCGGGC
TACTCGGCGGCGAGGTCGGCTTCCTCTCCTCGACGCTGATCGTGATCGACGTGACGATCGCGGCGCTCTT
CTGGGCTTGGGGCGCGGACGAGGATGTGCTGCAGCGCTTGGTCAAGAAGACGCTCTACATCGGGGTCTTT
GCCTTCATCATCGGCAACTTCCAGAGCCTCGCGACGATCATGCTCGAAAGCTTCGCGGGTCTCGGCCTCA
AGGCGAGCGGCGGGGCGATGGCGATCGGCGACTTCATGCGGCCGGGCGTCGTTGCGGCGACAGGGCTCGA
TGCGGCCGAGCCGCTGCTCGACGCCAGCGCCGACCTCCTGGGACCGGTCGGGCTCTTCACCAATTTCGTC
CAGATCATGATCCTGCTCGTCGCTTGGGTGATCGTGGTGCTCGCCTTCTTCATCCTCGCGGTACAGGTCT
TCGTGACGATCCTCGAGTTCAAGCTCGTCACGCTCGCGGGCTTCGTCCTCATCCCCTTCGCCTTTTTCGG
GCGGACAGCTTTCATGGCCGAGCGTGTCCTCGGGCATATCATATCGTCGGGCATCAAGGTGCTCGTACTC
GCCGTCATCACCGGTATCGGCACGACCTTGTTCGACCGCTTTCTCGAGGCCGGTATCGGCCCAGAGCCTG
ATATCGAGCAGGCGATGGCCATCGCACTCGGCGCGCTCACCTTGCTCGGTCTCGGCATCTTCGGCCCCAG
CATCGCGAACGGTATCGTCGCTGGCGGACCGCAGCTCGGAGCGGGCGCGGCAGCGGGAACCACGGTCGCG
GCGGGCGCCACCCTCGCCGCCGGTGCCGCCGGCGCGACGCTTGCGGGCGGCGCGGCGGCAACGGCAGCGC
GGGGCGCGGCTGCTGCCGGCGCCCGCGGTGCGGGAAGCGCATCGGCAGCCTATTCCGCGGGAGCGGCCGG
GAAGAGCGGGGCGAGGGCGGTCGGTTCCGGCCTGGCAAATGTCGCGCGCAGCGCCGCGAGCGGCGCCTCG
TCCCCGCTCCGCCGCGCGGCGGAGAAGCTTCGGGCGAACTTCGAGGCCGGGCGGGACGGGCCTGCCGATA
GCGCGGCGCCGGCCCGGCCCGCCGATGCGCCGCCCGCCTGGGCCGCAGCAATGCGCCGCCGCCAGATGGT
GACGCAGGGCGCCACCATCGGTGCCCAGACCCTGAAGGGTGGCGACAGCCACGGCGGCGGTTCGGCTCCC
GACATCAGCGAAAAGGACTGA
 Primer design