SecReT4
Protein ID: 103487961
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2482
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2620244..2620963 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ1GQ83
KEGG IDsal:Sala_2482
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|103487961|ref|YP_617522.1| conjugal transfer protein TrbJ [Sphingopyxis alaskensis RB2256]
MKTSFYRRTALAGLIAITMLSAGAVITPASAQIGGIVHDPRNYAQNILTAARTLEQINNQIKQLQNQATS
LVNEARNLQSLPVSTLQELQGQVDRTRELLGEAQRIAFDVGDIQKTFEARYKGASLSGPQAALVVNAEAR
WNDSVGAFQDAMKVQAGVVVNMGAARQSIGTLVTSSQSATGALQAAQAGNQLLALQSQQLGDLAAAIAAQ
GRAEMLDAARAAAAEAEGRERFRRFRKGN
 
Nucleotide Sequence: 720 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2620963-2620244 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAAGACAAGCTTTTATCGCCGCACAGCGCTGGCCGGCCTGATCGCGATCACGATGCTGTCGGCGGGCG
CAGTGATCACCCCCGCATCGGCGCAGATCGGCGGGATCGTCCACGATCCGCGCAACTATGCCCAGAATAT
CCTGACCGCAGCGCGCACGCTCGAGCAGATCAACAATCAGATCAAGCAGCTGCAGAACCAGGCGACCTCG
CTCGTCAACGAGGCGCGGAACCTGCAGAGCTTGCCGGTCTCGACGCTGCAAGAGCTGCAGGGCCAGGTCG
ACCGCACCCGCGAGCTGCTCGGTGAAGCGCAGCGCATCGCCTTCGACGTCGGCGACATCCAGAAGACGTT
CGAGGCGCGCTATAAGGGCGCATCGCTGTCGGGGCCGCAGGCGGCGCTCGTCGTCAATGCCGAGGCGCGC
TGGAACGACAGCGTCGGCGCCTTTCAGGACGCGATGAAGGTACAGGCCGGCGTGGTCGTCAACATGGGAG
CTGCGCGGCAGTCGATCGGCACGCTGGTGACCTCGAGCCAGTCGGCGACCGGCGCGCTGCAGGCGGCTCA
GGCGGGGAACCAGCTGCTCGCGCTCCAGTCGCAGCAGCTTGGCGACCTTGCCGCCGCGATCGCCGCACAG
GGCCGCGCCGAAATGCTCGATGCCGCACGCGCCGCCGCCGCGGAAGCCGAGGGCCGCGAACGCTTCCGCC
GCTTCCGCAAGGGCAATTGA
 Primer design