SecReT4
Protein ID: 103487962
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2483
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2620969..2623413 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ1GQ82
KEGG IDsal:Sala_2483
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2e-35, Aligned region: 442..718
CagE_TrbE_VirB [PF03135], Evalue: 3.2e-13, Aligned region: 182..388
Protein Sequence: 814 a.a.     [Download]
>gi|103487962|ref|YP_617523.1| conjugal transfer ATPase TrbE [Sphingopyxis alaskensis RB2256]
MMNLSEYRTKSARLADFLPWVCLVAEGVVLNKDGSFQRTARFRGPDLDSATPAELVAVTSRLNNTLRRLG
SGWAVFVEAQRVPAMTYPVSEFPDPVSELVDIERREQFREEGAHFESFYYLTLLWMPPAEEAARAEAWLY
EGRSKTGVDAQELLKSFADRTERVLHLVEGFMPEVEWLGDGETLTYLHSCISTKAQRVRVPETPAYLDAL
LADEALVGGLEPRLGDHHLRTLTITGFPSVTFPGLLDELNRQAFGYRWSSRAIMLDKTDATKLLTKIRRQ
WFAKRKSVAAILKEVMTNEASVLMDSDASNKAADADMALQELGADEAGIAYVTATITVWDRDPALAAEKL
RLVEKIVQSRDFTCTVEGVNALEAWFGSLPGHVYANVRQPPVSTLNLAHLIPLSAVWAGAERDEHFGQSP
LLYGKTEGSTPFRLSLHVGDVGHCLVVGPTGAGKSVLLALMAMQFRRYEGSQIFAFDYGGSIRAAALGMG
GDWQDLGGALHDAGSDGSVALQPLARIDEPAERAWAAEWLAALLTGEGVAVDPAAKEHLWSALTSLATAP
VTERTLTGLAVLLQSQELKLALSPYLVGGPWGRLLDAEVEHLGSARVQALETEGLVGASSAATVLSYLFH
RIERRLDGSPTLIIIDEGWLVLDSPAFAAQLREWLKTLRKKNASVIFATQSLADIEGSSIAPAIIESCPT
RIFLPNERAAEPQIARVYDRFGLNSRQVEILSRATPKRDYYCQSRRGNRLFDLGLGDIALAFAAASSKSD
QIRIGELMAAHGQDQFAAAWLRHRGLEWAADLLGNLEIAAPLKE
 
Nucleotide Sequence: 2445 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2623413-2620969 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGATGAATCTCTCCGAATATCGCACGAAATCCGCCCGCCTCGCTGACTTTCTCCCTTGGGTCTGCCTGG
TGGCGGAGGGCGTGGTGCTGAACAAGGATGGCTCCTTCCAGCGCACGGCGCGCTTCCGCGGGCCCGACCT
CGACAGCGCCACGCCCGCCGAACTTGTCGCGGTCACGTCGCGGCTCAACAACACGCTGCGCCGGCTGGGA
TCAGGCTGGGCCGTGTTCGTCGAGGCGCAGCGGGTCCCGGCCATGACCTATCCCGTGTCCGAGTTCCCCG
ACCCGGTATCGGAACTCGTCGATATCGAACGCCGCGAGCAGTTCCGCGAGGAGGGGGCGCATTTCGAGAG
CTTCTATTATCTGACCTTGCTCTGGATGCCGCCCGCCGAGGAGGCGGCGCGCGCCGAGGCCTGGCTCTAC
GAGGGCCGTTCGAAGACGGGCGTCGATGCGCAGGAATTGCTGAAAAGCTTCGCCGATCGCACCGAGCGCG
TGCTGCATCTTGTCGAGGGCTTCATGCCTGAGGTCGAATGGCTCGGTGACGGCGAGACGCTGACCTATCT
GCACAGCTGCATCTCGACCAAGGCCCAGCGCGTCCGCGTGCCCGAAACGCCGGCCTATCTCGACGCGCTG
CTCGCCGACGAGGCGCTGGTCGGCGGTCTCGAGCCGCGGCTCGGCGACCATCATCTGCGCACGCTCACCA
TAACCGGCTTTCCGAGCGTAACCTTCCCGGGGCTGCTCGACGAACTCAACCGCCAGGCCTTCGGCTATCG
CTGGTCGTCGCGCGCGATCATGCTCGACAAAACCGACGCGACCAAGCTGCTGACCAAGATTCGCCGGCAA
TGGTTCGCCAAGCGCAAGTCCGTCGCCGCAATCCTCAAGGAAGTGATGACCAACGAGGCGTCGGTCCTGA
TGGACAGCGATGCCTCGAACAAGGCGGCCGACGCCGACATGGCGTTGCAGGAGCTGGGCGCCGACGAAGC
GGGTATCGCCTATGTCACAGCGACGATCACGGTTTGGGACCGCGATCCGGCCTTGGCGGCCGAGAAGCTG
CGGCTGGTCGAGAAGATCGTCCAGAGCCGCGACTTCACCTGCACCGTCGAGGGCGTGAACGCGCTCGAAG
CCTGGTTCGGGAGCCTGCCGGGCCATGTCTATGCCAATGTCCGTCAGCCCCCGGTCTCGACGCTCAATCT
CGCCCATCTGATCCCGCTGTCGGCGGTGTGGGCGGGGGCGGAACGGGACGAGCATTTCGGTCAGTCCCCC
TTGCTTTACGGCAAGACCGAAGGTTCGACCCCGTTCCGCCTTTCGCTGCATGTCGGCGATGTCGGTCACT
GCCTCGTCGTCGGTCCGACCGGCGCCGGCAAGTCGGTGCTTCTGGCGCTGATGGCGATGCAGTTCCGCCG
CTATGAAGGCAGCCAGATCTTCGCCTTCGATTATGGCGGATCGATCCGCGCCGCGGCGCTTGGCATGGGC
GGCGACTGGCAGGATCTCGGCGGCGCGCTTCACGACGCGGGGAGCGACGGGTCGGTGGCGCTCCAGCCGC
TCGCGCGGATCGACGAACCGGCCGAGCGCGCATGGGCCGCCGAATGGCTTGCGGCGCTGCTCACGGGCGA
AGGCGTTGCGGTCGATCCGGCGGCGAAGGAGCATCTCTGGTCGGCATTGACTTCGCTCGCGACCGCGCCG
GTTACCGAGCGAACGCTCACTGGACTCGCCGTCTTGCTCCAGTCGCAGGAACTGAAGCTCGCCCTTTCGC
CATATCTCGTTGGCGGCCCATGGGGTCGCCTGCTCGATGCCGAGGTCGAGCATCTGGGCTCCGCGCGGGT
GCAGGCGCTTGAAACCGAAGGCTTGGTCGGCGCTTCGTCGGCGGCGACGGTCCTCTCCTATCTGTTCCAC
CGCATCGAGAGACGCCTCGACGGCTCGCCGACGTTGATCATCATCGACGAAGGCTGGCTCGTTCTCGACA
GCCCCGCCTTCGCCGCGCAACTGCGCGAATGGCTCAAGACGCTCCGCAAGAAGAATGCGAGCGTGATCTT
CGCGACGCAGAGCCTCGCCGATATCGAAGGGTCGAGCATCGCGCCCGCGATCATCGAAAGCTGCCCGACA
CGGATATTCCTGCCGAACGAGCGCGCCGCTGAGCCGCAGATCGCGCGGGTCTATGACCGCTTCGGCCTGA
ACAGCAGACAGGTGGAGATATTGAGCCGGGCGACGCCGAAGCGTGACTATTATTGCCAGTCACGGCGCGG
CAACCGACTGTTCGACCTTGGCCTCGGCGACATCGCGCTCGCCTTTGCCGCCGCCTCTTCGAAATCCGAC
CAGATTCGCATCGGCGAGCTGATGGCCGCGCATGGCCAAGACCAGTTCGCGGCGGCCTGGCTTCGCCATC
GCGGCCTCGAATGGGCCGCCGATCTGCTCGGCAATCTTGAAATCGCAGCCCCCCTGAAGGAGTGA
 Primer design