SecReT4
Protein ID: 103487963
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2484
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2623679..2624011 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ1GQ81
KEGG IDsal:Sala_2484
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.5e-24, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|103487963|ref|YP_617524.1| conjugal transfer protein TrbC [Sphingopyxis alaskensis RB2256]
MIHALRHGARRAMLCSTALFVALAVSAPAQAGGSSMPWEAPLQSILESIEGPVAKIVAVIIIIVTGLSLA
FGDTSGGFRRLVQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2624011-2623679 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGATCCATGCCCTCCGGCATGGCGCCCGCCGCGCCATGCTCTGTTCGACCGCACTTTTTGTCGCGCTCG
CGGTCTCGGCACCCGCTCAAGCCGGCGGCTCGTCGATGCCGTGGGAAGCGCCGCTTCAGTCGATCCTCGA
AAGCATCGAGGGTCCGGTCGCGAAGATCGTCGCGGTGATCATCATCATCGTGACCGGCCTCAGCCTCGCC
TTCGGCGACACCTCGGGCGGGTTCCGCCGGCTGGTCCAGATCGTCTTCGGTCTGTCGATCGCCTTCGCCG
CCTCGAGCTTCTTCCTCTCCTTCTTCTCCTTCGGCGGTGGAGCGCTGGTTTGA
 Primer design