SecReT4
Protein ID: 103487964
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2485
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2624008..2624991 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ1GQ80
KEGG IDsal:Sala_2485
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-85, Aligned region: 24..292
FtsK_SpoIIIE [PF01580], Evalue: 2.8e-05, Aligned region: 145..175
TrwB_AAD_bind [PF10412], Evalue: 6.8e-05, Aligned region: 147..183
Protein Sequence: 327 a.a.     [Download]
>gi|103487964|ref|YP_617525.1| type II secretion system protein E [Sphingopyxis alaskensis RB2256]
MGAEPIRLEARHRSARMLRTAMGGAIAEWLSDREIIEIMLNPDGRLWVDRLGLGIEDSGETLSAADGERI
IRLVAHHVGAEVHGAAPRVSAELPDGGERFEGLLPPVVAAPTFAIRKPAIAVFTLADYVAAGIMSSEAAD
ILRVGVRERLNILVAGGTGTGKTTLTNALLAEIAGSSDRIVLIEDTRELQCAAPNLVAMRTKDGVASLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGVGTIHAGSALGALRRMEQLIQEAVITVPRALLA
ETIDLVAVLVRDGSGRRLAELARVDGFDRLNLEYRLTPLITPEGDNR
 
Nucleotide Sequence: 984 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2624991-2624008 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGGGCGCAGAACCGATCCGGCTGGAGGCACGTCATCGCAGCGCACGCATGCTGCGCACGGCGATGGGCG
GCGCGATCGCCGAGTGGCTCTCCGACCGCGAAATCATCGAGATCATGCTCAACCCCGACGGGCGGCTCTG
GGTCGATAGGCTTGGCCTCGGGATCGAGGACAGCGGCGAGACGCTGAGCGCGGCCGATGGCGAACGCATT
ATCCGCCTTGTCGCGCATCACGTCGGCGCCGAGGTCCACGGGGCTGCACCGCGCGTGTCCGCCGAGCTTC
CCGATGGCGGCGAGCGCTTCGAGGGATTGCTGCCGCCCGTCGTCGCCGCGCCGACATTCGCCATCAGAAA
ACCGGCTATCGCGGTCTTCACGCTCGCCGACTATGTCGCCGCGGGCATCATGTCGTCCGAGGCCGCGGAC
ATCCTTCGCGTCGGCGTGCGCGAGCGTCTGAACATCCTCGTCGCCGGCGGCACGGGCACCGGCAAGACCA
CGCTGACCAACGCGCTCCTCGCTGAGATTGCGGGCAGCAGCGACCGCATCGTGCTGATCGAGGATACGCG
CGAATTGCAGTGCGCGGCGCCGAACCTCGTCGCAATGCGCACTAAGGATGGTGTCGCCTCGCTCTCCGAC
CTCGTGCGCTCCTCGCTCCGCCTCCGGCCCGATCGCATTCCGATCGGCGAGGTTCGCGGCGCCGAGGCGC
TCGATCTTCTGAAGGCATGGGGCACCGGTCATCCGGGCGGTGTGGGCACGATCCACGCGGGTAGTGCGCT
CGGCGCGCTCCGCCGGATGGAGCAGCTCATCCAGGAAGCGGTGATCACCGTCCCGCGCGCGTTGCTCGCC
GAGACGATCGATCTCGTCGCCGTGCTCGTCCGCGACGGTAGTGGCCGGCGCCTTGCCGAACTCGCACGCG
TCGACGGCTTCGACCGGCTGAACCTCGAATATCGCCTCACGCCCCTCATCACCCCCGAAGGAGACAATCG
ATGA
 Primer design