SecReT4
Protein ID: 103487969
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2490
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2630441..2632330 [-]
ProductType IV secretory pathway VirD4 components-like protein
Component typeTraG
UniProt IDQ1GQ75
KEGG IDsal:Sala_2490
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5.7e-123, Aligned region: 170..560
TraG-D_C [PF12696], Evalue: 7.6e-19, Aligned region: 420..538
AAA_10 [PF12846], Evalue: 3.6e-18, Aligned region: 184..491
T4SS-DNA_transf [PF02534], Evalue: 3.6e-11, Aligned region: 404..521
DUF87 [PF01935], Evalue: 9.8e-06, Aligned region: 181..227
AAA_16 [PF13191], Evalue: 6.4e-05, Aligned region: 183..347
Protein Sequence: 629 a.a.     [Download]
>gi|103487969|ref|YP_617530.1| Type IV secretory pathway VirD4 components-like protein [Sphingopyxis alaskensis RB2256]
MRDRDQRIHADALRRHWRSNQVRRFKRHAIIFAASIALGGLTLPYLMLTPTTMQATGTWYVARLKTWISS
GTEAEPGVMISGGGERYEASARLVAAHPYYRRSADTVIAFFIRGCLLGFIAWLAGLILLRGAMARRRELM
LRDRVIGGTIVTTEKKLAQLTRAEAGDHALAIATVPMPPRLETRHMAMVGTTGSGKTTVLRQILDGVEAR
GEAALVYDTSGEFVAQYYDPRRGDIILNPFDARCAIWTPFAEIAHPADADRIAQQLITETGQHDRDVWLE
TSRILVANMIRALWREGKCTLPDLLHALQVRSKDDLKLWLGNSSSARTFADDADRATGSVLFMLAKAANL
IQFLRIDEGKETAFSFRDFLSGLDMHPGPKPWIFVPRKEDYFEASKPLLACWLECAASALLGHSPSAERR
LWFILDELADLPRVDNLARLLPEGRKFGAAVILTFQAIGQMRHRYGQDLSESMLGCCNTKLFLQMTDSES
RQWASDTIGSCEVELPTMTDALADGDYKPRTTLGRQRKVRPAVLESELRLPRHRGYLLFPDGLPVARIAL
TDDHIVRRGKARQLGYVAGDPTTSLWQQSVEAPPVGTPPVEAEPAVQPSTVPPTEPEPPKPQPSGDGPV
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2632330-2630441 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGCGCGATCGGGACCAGCGTATCCATGCCGACGCGCTGCGGCGCCACTGGCGATCGAACCAGGTCCGGC
GGTTCAAGCGCCATGCGATCATCTTCGCGGCATCGATCGCGCTCGGCGGCCTGACGCTCCCCTATCTGAT
GCTGACGCCGACGACGATGCAGGCGACCGGGACCTGGTATGTCGCGCGATTGAAGACGTGGATATCGAGC
GGCACCGAAGCCGAACCGGGCGTCATGATCAGCGGTGGAGGAGAGCGCTACGAGGCATCGGCTCGATTGG
TCGCGGCGCATCCCTATTATCGCCGGTCGGCCGACACGGTGATTGCCTTCTTCATACGAGGATGCTTGCT
GGGGTTCATCGCCTGGCTGGCGGGCCTGATCTTGCTGCGCGGCGCGATGGCACGGCGGCGCGAACTCATG
CTTCGCGATCGCGTGATCGGGGGGACGATCGTTACGACCGAGAAGAAGCTCGCGCAGCTGACGCGTGCCG
AAGCAGGGGACCATGCCCTGGCCATCGCGACGGTGCCCATGCCGCCACGCCTCGAAACCCGCCACATGGC
GATGGTCGGCACGACCGGAAGCGGAAAGACCACGGTGCTGCGTCAGATACTCGATGGCGTCGAGGCGCGC
GGCGAGGCGGCGCTCGTCTACGACACGAGCGGTGAGTTCGTCGCCCAATATTATGATCCCCGGCGCGGCG
ACATCATCCTAAATCCGTTCGATGCGCGCTGCGCTATTTGGACGCCCTTCGCCGAGATTGCGCATCCGGC
GGATGCCGACCGCATCGCGCAGCAGCTTATCACCGAGACCGGACAGCATGATCGCGACGTGTGGCTCGAA
ACGAGCCGCATCCTCGTCGCCAACATGATCCGCGCGCTGTGGCGCGAGGGCAAATGCACCCTGCCCGATC
TGCTCCATGCATTGCAGGTGCGGTCAAAGGACGATCTCAAGCTATGGCTGGGGAACAGTTCGTCGGCGCG
CACCTTCGCTGACGATGCCGACCGCGCGACGGGAAGCGTGCTCTTCATGCTCGCCAAGGCCGCGAACCTC
ATCCAGTTCCTGCGCATCGACGAGGGCAAGGAGACGGCCTTTTCTTTCCGCGATTTTTTATCGGGGCTCG
ACATGCATCCCGGTCCGAAGCCCTGGATCTTCGTGCCGCGGAAAGAGGATTATTTCGAGGCCTCGAAGCC
GCTGCTTGCCTGCTGGCTCGAATGCGCCGCGAGCGCCCTGCTCGGGCATTCGCCCTCGGCCGAGCGCCGC
CTCTGGTTCATCCTCGACGAACTCGCCGACCTGCCGCGCGTCGACAATCTCGCGCGGCTGCTACCCGAGG
GGCGCAAGTTCGGGGCGGCGGTCATCCTCACCTTTCAGGCGATCGGGCAGATGCGACATCGCTACGGACA
GGATTTGTCCGAATCGATGCTCGGCTGCTGCAACACCAAGCTGTTCCTCCAGATGACCGACAGCGAATCC
CGGCAATGGGCGAGCGACACCATCGGAAGCTGCGAGGTCGAGCTGCCGACGATGACCGATGCCCTCGCCG
ACGGCGACTACAAGCCGCGCACGACGCTCGGCCGCCAGCGCAAGGTCCGGCCCGCCGTCCTCGAGAGCGA
ACTGCGCCTTCCCAGGCATCGCGGCTATTTGCTGTTCCCCGATGGATTGCCGGTCGCGCGCATCGCGCTC
ACCGACGACCATATCGTGCGGCGCGGCAAGGCGCGCCAGCTCGGATATGTCGCGGGCGATCCCACGACCA
GCCTCTGGCAGCAGTCCGTCGAAGCGCCGCCGGTCGGGACACCGCCGGTTGAAGCGGAGCCCGCCGTGCA
ACCATCGACGGTGCCGCCCACCGAGCCGGAGCCGCCGAAACCACAGCCGAGCGGCGACGGACCAGTCTGA
 Primer design