SecReT4
Protein ID: 103487971
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2492
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2633048..2633776 [-]
Productlytic transglycosylase, catalytic
Component typeTrbN
UniProt IDQ1GQ73
KEGG IDsal:Sala_2492
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|103487971|ref|YP_617532.1| lytic transglycosylase, catalytic [Sphingopyxis alaskensis RB2256]
MTVVRLRRSLTILSVLCSPMRVGARRAAISAALLLPPICTPAAAAAQSERHPYAAPVAEAAQRFGIPELW
IWRVMHAESRGRIGAVSHAGAMGLMQIMPATWAPLTARHRLGSDPFDPRANILAGAAYLRAMWDRYGDVR
LMLAAYNAGPGRADAYVAGRRGLPAETRAYVAKIAPELHAPLGTSAVASLPRGSPGWRDAAIFVAPAAAI
DTARPAASAGEAAAIPDAGSPLFIARSGQHRP
 
Nucleotide Sequence: 729 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2633776-2633048 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGACAGTTGTGCGGCTGCGGCGAAGTCTCACCATACTGTCTGTCCTGTGCTCGCCGATGCGCGTCGGCG
CACGGCGCGCGGCCATTTCGGCTGCGCTGCTTTTGCCGCCGATCTGCACTCCGGCTGCCGCCGCAGCGCA
GTCGGAGCGCCATCCCTATGCCGCTCCGGTCGCCGAAGCGGCGCAGCGCTTCGGTATCCCGGAGCTCTGG
ATCTGGCGCGTGATGCATGCCGAAAGCCGCGGCCGTATCGGCGCCGTGTCGCACGCCGGCGCCATGGGGC
TCATGCAGATCATGCCCGCAACATGGGCGCCGCTGACGGCGCGCCACCGGCTCGGTTCGGACCCGTTCGA
CCCCCGCGCGAACATCCTCGCGGGCGCCGCCTATCTGCGCGCGATGTGGGACCGCTATGGCGATGTCCGG
CTGATGCTCGCGGCCTATAATGCAGGTCCCGGCCGCGCCGATGCCTATGTCGCGGGGCGTCGCGGACTGC
CAGCCGAGACGCGCGCCTATGTCGCGAAGATTGCGCCCGAACTGCACGCGCCGCTTGGAACTTCTGCCGT
CGCTTCGCTTCCAAGAGGGTCGCCGGGCTGGCGCGATGCGGCCATTTTTGTTGCACCAGCGGCGGCGATC
GACACTGCGCGCCCGGCAGCTTCGGCAGGTGAAGCTGCCGCCATCCCGGACGCAGGTTCGCCGCTTTTCA
TTGCTCGGTCCGGGCAGCATCGGCCATGA
 Primer design