SecReT4
Protein ID: 103487972
T4SS name [ID]Trb [328]
Gene symbol-
Locus tagSala_2493
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2633773..2634363 [-]
Productconjugal transfer protein traF
Component typeTraF
UniProt IDQ1GQ72
KEGG IDsal:Sala_2493
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.9e-47, Aligned region: 32..168
Protein Sequence: 196 a.a.     [Download]
>gi|103487972|ref|YP_617533.1| conjugal transfer protein traF [Sphingopyxis alaskensis RB2256]
MNRRFLCATVGAAALFTASFVAVAWLKPAPRLLWNASASAPIGVYRIDVGARPRLGELVAIDPPPALAIY
LSRRGYLPRGVPLLKRVAALPGSLVCRSGASVTIDGAGVARALARDGADRPLPVWRGCRIVGAQELFLIN
AARGSLDGRYFGPISASGLIGTAHPVLTRTDAEASLRWHRASPSFEPIADEMEQGR
 
Nucleotide Sequence: 591 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2634363-2633773 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAACCGCCGGTTCTTGTGCGCGACGGTCGGCGCAGCGGCGCTGTTTACCGCTTCTTTCGTCGCAGTCG
CCTGGCTGAAGCCGGCGCCGCGACTGCTCTGGAATGCGAGCGCCAGCGCCCCCATCGGCGTGTACCGGAT
CGATGTCGGTGCGCGGCCTCGGCTCGGCGAGCTTGTCGCCATCGACCCGCCGCCGGCGCTTGCGATCTAT
CTTTCCCGTCGCGGCTATCTGCCGCGCGGCGTTCCGCTGCTGAAGCGCGTCGCCGCGCTTCCGGGCTCTC
TGGTCTGCCGTTCGGGTGCATCCGTCACGATCGACGGCGCGGGCGTCGCCCGTGCGCTGGCGCGCGACGG
GGCGGATCGTCCGCTCCCGGTCTGGCGCGGTTGCCGGATCGTCGGGGCGCAGGAATTATTCCTGATCAAT
GCCGCGCGGGGCAGCCTCGACGGGCGATATTTCGGGCCGATTTCGGCGTCCGGACTCATCGGCACGGCGC
ACCCTGTTCTGACGCGCACCGACGCCGAAGCATCGCTTCGCTGGCACCGCGCGAGCCCTTCCTTCGAACC
AATTGCCGACGAGATGGAGCAAGGACGATGA
 Primer design