SecReT4
Protein ID: 103488084
T4SS name [ID]Trb [329]
Gene symbol-
Locus tagSala_2606
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2748213..2749226 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ1GPW0
KEGG IDsal:Sala_2606
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.3e-68, Aligned region: 105..328
Protein Sequence: 337 a.a.     [Download]
>gi|103488084|ref|YP_617645.1| conjugal transfer protein TrbG/VirB9/CagX [Sphingopyxis alaskensis RB2256]
MRQISFRKAVPALLISASALGACTTTSAKPRTIVHEAPREVLATPAPEPVPHVRVVAIPEPLPLPGQLKP
VESSMPPPETADPRRRVSTANAAARVQPSRDGYLNAIQQYPWTDGALYQVYAAPGQVTDIALQEGEQLVG
PGPVAAGDTVRWIIGDTVSGSGANARVHILIKPTRPDISTNLVINTDRRTYHLELRATPSTWMASVSWTY
PHDQLIALRAAEAERARDTPLASGIDIATLNFRYRIDGDRPDWRPVRVFDDGRQIFIEFAEGVERTDMPP
LFVTGDTGAAELVNYRVAGRYMIVDRLFSRAELRLASGKREARVSIERESPRRKGRS
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2749226-2748213 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAGACAGATTTCATTTCGCAAGGCTGTTCCCGCTTTGCTGATCTCCGCGTCGGCGCTTGGCGCCTGCA
CCACGACGTCGGCGAAGCCGCGCACCATCGTCCATGAAGCGCCGCGCGAGGTGTTGGCGACCCCGGCTCC
CGAGCCGGTGCCTCACGTGCGGGTCGTCGCGATCCCCGAACCGCTGCCGCTGCCGGGCCAATTGAAGCCG
GTAGAGAGCAGCATGCCGCCACCGGAGACGGCTGATCCGCGCCGGCGCGTGAGCACCGCCAATGCCGCGG
CTCGTGTGCAGCCCTCCCGCGACGGCTATCTCAATGCGATTCAGCAATATCCCTGGACCGATGGTGCGCT
CTATCAGGTCTATGCCGCTCCGGGCCAGGTGACGGACATCGCGCTTCAGGAAGGCGAACAACTTGTAGGC
CCTGGGCCGGTCGCGGCGGGGGACACGGTGCGCTGGATCATCGGCGACACCGTAAGCGGCAGCGGCGCGA
ACGCTCGCGTTCATATCCTCATCAAACCCACCCGGCCGGACATCTCGACCAACCTCGTCATCAACACCGA
CCGGCGCACCTATCATCTCGAACTGCGCGCGACGCCTTCGACCTGGATGGCCTCGGTGTCGTGGACCTAT
CCGCACGATCAGCTTATCGCCCTACGGGCCGCCGAAGCCGAGCGGGCGCGCGATACGCCGTTGGCTTCGG
GCATCGATATCGCGACCCTCAATTTTCGCTATCGGATCGACGGGGACCGGCCCGACTGGCGGCCGGTGCG
CGTGTTCGATGATGGCCGGCAAATCTTCATAGAATTTGCCGAAGGCGTGGAACGCACCGACATGCCGCCG
CTATTCGTCACTGGCGACACCGGGGCCGCCGAGCTGGTTAATTACCGCGTGGCGGGCCGCTACATGATCG
TCGACCGGCTCTTTTCCCGTGCCGAACTGCGGCTTGCGTCCGGCAAACGCGAGGCGAGGGTCAGCATCGA
GCGCGAAAGCCCGCGCCGCAAGGGCCGGTCATGA
 Primer design