SecReT4
Protein ID: 103488086
T4SS name [ID]Trb [329]
Gene symbol-
Locus tagSala_2608
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2749925..2751298 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1GPV8
KEGG IDsal:Sala_2608
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-49, Aligned region: 37..262
Protein Sequence: 457 a.a.     [Download]
>gi|103488086|ref|YP_617647.1| conjugal transfer protein TrbL [Sphingopyxis alaskensis RB2256]
MNDTGVIDTFLGVFTGYIDSGFGLLGGEVGFLSSTLIAIDVTIAALFWAWGADEDVLQRLVKKTLYIGVF
AYIIGNFSQLAAILFDSFAGLGLKASGGGMALADFMKPGMVAATGLDAGAPLLDATEDLVGPVGLFTNFP
EIMILLVAWLIVVLAFFVLAIQVFVTIIEFKLVTLAGFVLLPFAFFNRTAFMAEKVLGHVISSGVKVLVL
AVITGIGTTLFTQFINAGVGPEPDIEQVMAIALGALTLLGLGIFGPGIANGIVAGGPQLGAGAAAGTALV
AGASLVGGAAGAKLAAGAAGSAAAAGGRMAAGAASAGARAAGSSAAAYSMGSFGKTGASAVAGGMAATGE
AALASAGRATASPLRKIADKAGQTLRSNFRSGARSAFGAESEGGAAATATSARSAAGTASSPNDQPAWAK
AMKHRQAMTQGATMATHTLKGGDSHGGGNGPDVSDKS
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2751298-2749925 Sphingopyxis alaskensis RB2256 chromosome, complete genome
GTGAACGACACCGGCGTAATCGACACCTTCCTCGGCGTCTTCACCGGCTATATCGACAGCGGGTTCGGGC
TGCTTGGCGGAGAAGTCGGCTTCCTGTCCTCGACCCTGATCGCGATCGACGTGACGATCGCCGCCCTGTT
TTGGGCTTGGGGCGCCGACGAGGACGTGCTGCAGCGCCTGGTCAAGAAGACACTCTATATCGGCGTCTTC
GCTTACATCATCGGCAACTTCTCGCAGCTAGCCGCAATCCTGTTCGACAGCTTCGCCGGGCTCGGCCTCA
AGGCTTCGGGTGGCGGGATGGCGCTCGCCGATTTCATGAAACCCGGCATGGTCGCGGCGACCGGCCTCGA
TGCCGGCGCGCCGCTGCTCGACGCGACCGAGGATCTGGTCGGGCCGGTCGGCCTCTTCACCAATTTCCCC
GAGATCATGATCCTGCTCGTCGCTTGGCTGATCGTGGTGCTCGCTTTCTTCGTGCTCGCCATCCAGGTGT
TCGTCACCATCATCGAGTTCAAGCTGGTGACGCTCGCCGGCTTCGTGCTGCTTCCCTTCGCCTTCTTCAA
TCGCACCGCCTTCATGGCCGAGAAGGTGCTGGGGCATGTCATCTCGTCGGGAGTCAAGGTGCTGGTGCTG
GCGGTCATCACCGGCATTGGCACGACGCTGTTCACCCAGTTCATCAATGCCGGCGTCGGCCCCGAACCCG
ACATCGAACAGGTCATGGCGATCGCGCTCGGAGCGCTGACGTTGCTCGGGCTCGGCATTTTTGGTCCCGG
CATCGCCAACGGCATCGTCGCCGGTGGGCCGCAACTTGGCGCAGGCGCCGCTGCCGGCACGGCGCTCGTC
GCTGGGGCGTCGCTCGTTGGCGGCGCGGCGGGCGCAAAGCTGGCGGCCGGCGCAGCCGGTTCCGCCGCTG
CAGCAGGCGGCAGGATGGCGGCTGGCGCCGCCAGTGCCGGTGCCCGTGCCGCTGGTTCGAGCGCCGCTGC
CTACAGCATGGGCTCATTCGGCAAGACTGGCGCCAGTGCCGTTGCCGGAGGGATGGCCGCTACGGGAGAG
GCGGCGCTTGCCAGTGCCGGCAGGGCTACTGCTTCACCCTTGCGCAAGATAGCCGACAAGGCCGGGCAGA
CGCTGCGGTCGAACTTTCGCAGCGGCGCCCGATCGGCTTTCGGCGCGGAGTCGGAGGGCGGGGCCGCCGC
GACGGCCACTTCTGCTCGATCCGCAGCAGGAACCGCGTCCTCGCCGAACGACCAGCCCGCTTGGGCGAAG
GCGATGAAGCATCGCCAGGCCATGACGCAGGGCGCCACCATGGCGACGCACACGCTCAAGGGCGGCGACA
GCCACGGCGGCGGCAATGGCCCCGACGTCTCCGACAAGAGCTGA
 Primer design