SecReT4
Protein ID: 103488091
T4SS name [ID]Trb [329]
Gene symbol-
Locus tagSala_2613
StrainSphingopyxis alaskensis RB2256
Repliconchromosome [GenBank: NC_008048] [Browse all T4SS(s) in this replicon]
Location [Strand]2755019..2755363 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ1GPV3
KEGG IDsal:Sala_2613
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-23, Aligned region: 18..104
Protein Sequence: 114 a.a.     [Download]
>gi|103488091|ref|YP_617652.1| conjugal transfer protein TrbC [Sphingopyxis alaskensis RB2256]
MKAKKTRLLAGTALDRLGVLAVTSAGLLITAPAHAGGSSMPWEAPLQSILESIEGPVAKIVAVIIIIVTG
LSLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 345 bp     [Download]
>gi|103485498|ref|NC_008048.1|:c2755363-2755019 Sphingopyxis alaskensis RB2256 chromosome, complete genome
ATGAAAGCAAAGAAGACCCGGCTGCTGGCCGGGACCGCCCTCGATCGCCTCGGCGTGCTGGCCGTCACGT
CCGCCGGGCTTCTCATCACCGCGCCGGCGCACGCAGGCGGTTCGTCGATGCCCTGGGAAGCGCCCCTCCA
GTCCATCCTCGAATCGATCGAAGGCCCGGTGGCGAAGATCGTTGCCGTTATCATCATCATCGTGACCGGC
CTCAGCCTCGCCTTCGGCGACACCTCGGGCGGGTTCCGGCGGCTGATCCAGATCGTGTTCGGCCTGTCGA
TCGCCTTTGCCGCCAGCTCCTTCTTCCTCAGCTTCTTCAGCTTCGGCGGCGGGGCGCTGGTGTGA
 Primer design