SecReT4
Protein ID: 107027184
T4SS name [ID]VirB [390]
Gene symbol-
Locus tagBcen_4843
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome 2 [GenBank: NC_008061] [Browse all T4SS(s) in this replicon]
Location [Strand]2109780..2111453 [-]
ProductTRAG protein
Component typeVirD4
UniProt IDQ1BKY3
KEGG IDbcn:Bcen_4843
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-105, Aligned region: 5..436
TraG-D_C [PF12696], Evalue: 1.7e-28, Aligned region: 282..403
TrwB_AAD_bind [PF10412], Evalue: 1.5e-23, Aligned region: 191..417
Protein Sequence: 557 a.a.     [Download]
>gi|107027184|ref|YP_624695.1| unnamed protein product [Burkholderia cenocepacia AU 1054]
MVGRWRGRYLRFAGQQFVLLAAPARSGKGVGIVIPNLLSYSDSVVVLDIKQENFRLTAGFRRAHGQAVYL
FNPFAEDGCTHRYNPLSVIADDMFRVGDILAIGYVLYPAGGHDEFWKDQARNLLLGLVLLLCDLREARRA
GASGVPDYPITMGEVLRQSSGNGQPVKTYLNRMLIQHRQYLSRACIDALNRFLANDDKVLASILATFNAP
LTIWANPIVDAATSANDFDLRDVRRRKMSVYLGVTPDHLSEAAILMNLMFSQLVNLNTKELAEDNPALKY
QCLLLLDEMTAIGKIQIIARAVAYMAGYNLRLLSIVQSDSQLESVYGRADARTIVTNHAMQILFAPREQK
DANAYSEMLGTRTERSRTTSRSNGMFGARGGASESFSDQRRALMLPQEIKELARDKEIILLENTKPILAD
RICYWRDRAFTSRVMDAPAVPALDLVRFGAQIEQRLRELSDDDVDEQTGELTHVRADYLELVHAWDPREL
PQALDNVSCEEAAAYVDRHFTLLGVPAEDVARAGRRLARGEDGMTDTETGARKRDPSPVARASGGVQ
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|107025343|ref|NC_008061.1|:c2111453-2109780 Burkholderia cenocepacia AU 1054 chromosome 2, complete sequence
GTGGTGGGCCGTTGGCGTGGCCGCTATCTGCGCTTTGCCGGTCAGCAATTCGTGCTACTTGCCGCGCCCG
CTCGTTCAGGAAAGGGCGTGGGGATTGTGATCCCGAATCTGCTGAGCTATTCCGACTCCGTGGTCGTGCT
TGATATCAAACAGGAAAATTTTCGTCTCACGGCAGGCTTTCGGCGCGCGCACGGACAAGCCGTGTACCTG
TTCAATCCGTTTGCAGAAGATGGCTGCACGCACCGCTACAACCCGTTGTCGGTCATTGCAGACGACATGT
TTCGCGTCGGCGACATTCTGGCGATCGGTTATGTGTTGTATCCGGCCGGCGGGCATGACGAATTCTGGAA
AGACCAGGCACGCAACCTTCTGTTGGGACTGGTCCTGCTGCTGTGCGATTTGCGTGAGGCGCGTCGTGCT
GGCGCGAGCGGGGTGCCCGACTACCCGATCACAATGGGCGAGGTATTGCGGCAATCGTCGGGAAATGGTC
AGCCGGTCAAAACCTACTTGAACCGGATGCTTATACAGCATCGACAGTACTTGAGCCGCGCCTGTATTGA
TGCACTGAATCGATTCCTCGCGAATGACGACAAGGTCCTGGCGAGCATTCTGGCCACTTTTAATGCGCCA
CTGACGATCTGGGCCAACCCGATTGTTGACGCGGCGACGAGCGCGAACGACTTTGATCTGCGAGACGTCA
GACGCCGCAAGATGTCCGTATATCTTGGCGTGACGCCCGATCACTTAAGTGAGGCGGCGATACTGATGAA
TCTGATGTTCTCGCAGCTCGTGAATCTGAACACGAAGGAGTTGGCAGAGGACAATCCGGCATTGAAGTAT
CAATGCCTGCTGCTGCTCGACGAGATGACGGCAATCGGAAAAATCCAGATTATCGCGCGTGCGGTGGCCT
ATATGGCGGGCTACAACCTGCGCCTACTCTCGATCGTGCAGTCCGACTCGCAGCTCGAGTCTGTGTATGG
CCGAGCTGACGCGAGGACCATTGTCACGAATCATGCGATGCAGATTCTTTTCGCCCCGCGCGAACAGAAG
GACGCCAATGCCTACTCCGAGATGCTCGGCACGCGCACGGAGCGATCGCGCACCACGAGCCGATCGAATG
GCATGTTCGGTGCGCGCGGCGGTGCGAGCGAGAGCTTTTCCGATCAACGTCGTGCGCTGATGTTGCCGCA
GGAGATCAAGGAGCTCGCGCGCGACAAGGAAATCATTCTTCTCGAAAATACCAAGCCGATTTTGGCAGAC
CGGATCTGCTATTGGCGCGATCGTGCATTTACTTCACGGGTAATGGACGCGCCAGCGGTGCCTGCACTCG
ATCTCGTGAGATTTGGTGCACAAATCGAGCAGCGGCTGCGCGAACTGAGCGATGACGACGTCGATGAACA
GACGGGCGAGCTGACGCATGTGCGAGCGGACTATCTGGAACTTGTACACGCCTGGGATCCGCGCGAGCTG
CCGCAGGCGCTGGACAATGTCAGTTGCGAGGAGGCAGCCGCGTATGTGGATCGGCATTTCACGCTGCTGG
GCGTGCCGGCCGAGGACGTAGCGCGCGCCGGACGTCGGTTGGCGCGCGGCGAAGATGGCATGACTGATAC
TGAGACGGGCGCGCGCAAGCGCGACCCGAGCCCCGTCGCCCGGGCAAGTGGTGGTGTTCAATGA
 Primer design