SecReT4
Protein ID: 107027186
T4SS name [ID]VirB [390]
Gene symbol-
Locus tagBcen_4845
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome 2 [GenBank: NC_008061] [Browse all T4SS(s) in this replicon]
Location [Strand]2111856..2112914 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ1BKY1
KEGG IDbcn:Bcen_4845
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-60, Aligned region: 5..309
MobB [PF03205], Evalue: 3.6e-05, Aligned region: 161..190
Protein Sequence: 352 a.a.     [Download]
>gi|107027186|ref|YP_624697.1| unnamed protein product [Burkholderia cenocepacia AU 1054]
MRSFAPLLADEAVTELVINRPQRILTETHRGWQAHDLPELDFERLMAFAVAIATLTNQGVSTEHPLLSAL
LPDNARLQLVVPPVVPPRTVSITIRRPSADEKTLECHRADGMFEDTVWRHVDGLGKTGLALRGADRMLVE
RLEARDFSAFFESAVRARRNIVIVGSTGSGKTSFMRSLCRYLSATERIVTIEDVRELFIRHLENCVHLLY
SKGAQGRAHITPADLIACAMRMRPDRVLLAELRGAEAYDFLKLLTTGHAGSMTSFHASSAGIAIERFALM
AKEHPEAAAWDIASLKRVLRLTIDVIAHMEAQPVLDSHGVQVGKRWAMTEVWFDPREKAAIEFDPTERCC
DA
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|107025343|ref|NC_008061.1|:c2112914-2111856 Burkholderia cenocepacia AU 1054 chromosome 2, complete sequence
ATGCGTTCGTTCGCACCGTTGCTCGCCGACGAAGCGGTAACGGAGCTCGTAATCAACCGACCGCAGCGTA
TTCTGACAGAGACCCATCGGGGGTGGCAGGCACACGATTTACCGGAGCTTGATTTCGAACGACTCATGGC
GTTCGCCGTGGCGATTGCCACATTGACGAATCAGGGCGTCTCGACCGAGCATCCGCTGCTTTCCGCGCTA
TTACCGGATAACGCGCGCCTCCAACTCGTGGTGCCGCCCGTGGTTCCGCCGCGGACGGTATCGATCACGA
TCAGGCGCCCGAGCGCGGATGAAAAGACGCTTGAGTGCCATCGTGCCGATGGCATGTTTGAGGACACGGT
TTGGCGACACGTTGACGGTCTCGGCAAGACAGGCCTAGCGTTGCGCGGAGCCGATCGGATGCTCGTCGAG
CGGCTCGAAGCGCGTGATTTTTCCGCCTTCTTTGAAAGCGCCGTGCGAGCACGCCGCAATATTGTCATTG
TCGGCAGCACGGGCTCCGGCAAGACGAGCTTTATGCGCAGCTTGTGCCGATACCTGAGCGCAACCGAGCG
CATCGTGACGATCGAAGACGTACGCGAGCTGTTCATTCGGCATCTCGAAAACTGCGTCCATCTCCTCTAT
AGCAAAGGCGCTCAGGGGCGCGCACACATAACGCCTGCAGATTTGATTGCCTGCGCCATGCGCATGCGTC
CCGACCGGGTGTTGCTTGCCGAGCTCCGCGGGGCGGAAGCGTACGACTTCCTGAAGCTTTTGACCACCGG
GCACGCCGGCTCGATGACGAGTTTTCATGCGTCCAGTGCGGGCATTGCCATCGAGCGTTTTGCGCTCATG
GCGAAGGAGCATCCCGAGGCAGCCGCCTGGGACATTGCTTCGCTCAAGCGTGTGCTGCGCTTGACCATCG
ACGTGATCGCTCACATGGAGGCGCAGCCCGTATTGGACTCACACGGTGTGCAGGTCGGCAAACGCTGGGC
GATGACCGAAGTCTGGTTCGACCCGCGCGAGAAGGCTGCCATCGAGTTTGACCCAACCGAGAGGTGCTGC
GATGCATGA
 Primer design