SecReT4
Protein ID: 107027189
T4SS name [ID]VirB [390]
Gene symbol-
Locus tagBcen_4848
StrainBurkholderia cenocepacia AU 1054
Repliconchromosome 2 [GenBank: NC_008061] [Browse all T4SS(s) in this replicon]
Location [Strand]2115041..2115745 [-]
Productvirulence protein
Component typeVirB8
UniProt IDQ1BKX8
KEGG IDbcn:Bcen_4848
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-48, Aligned region: 10..220
Protein Sequence: 234 a.a.     [Download]
>gi|107027189|ref|YP_624700.1| unnamed protein product [Burkholderia cenocepacia AU 1054]
MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSVAALAVMMPFYRVVPLPIEVNKLTGEAQ
FIEVLDAKHVPLREIEDKHWVEVYVRTRERYDWGLLQMDYDRVLDMSDESVARAYRQIYSGPNALDQQLG
ASVQYRTRIVSTTLVPDEPGHAVVHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGF
KVTAYSRDAEDTPPAPQPGAGAGR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|107025343|ref|NC_008061.1|:c2115745-2115041 Burkholderia cenocepacia AU 1054 chromosome 2, complete sequence
GTGAACGATCAAAGCGATTATCGGCGTGCGCTTGATTTTGAGGCGTCGCTCACCGCATTGCAGGCATGCT
CCGAACGTCGCGCATGGCAAGTGGCGTTTGCCGCCGTTATTGTTGCGATCGGTTCGGTAGCGGCGCTTGC
CGTGATGATGCCGTTTTATCGCGTGGTGCCGTTGCCTATCGAGGTGAACAAGCTCACCGGCGAGGCGCAA
TTCATCGAGGTGCTCGACGCAAAACACGTGCCGCTGCGTGAGATCGAAGATAAGCACTGGGTCGAAGTCT
ATGTACGCACTCGCGAGCGCTACGACTGGGGACTGTTGCAAATGGATTATGACCGTGTCCTGGATATGAG
CGACGAATCGGTCGCGCGCGCATATCGTCAAATCTATAGCGGTCCGAACGCGTTGGATCAGCAACTGGGC
GCGTCAGTTCAATACCGCACCCGAATAGTGTCGACGACGCTCGTGCCCGACGAGCCGGGACATGCTGTCG
TGCATCTCGAGCGAACGGTGCGCAAGAACGGCATCGATACCGGTGAGCCAGCAAAGCGCTTTGTGATTAC
GCTCGCCTTTACCTACCGCCCCACGGTGCTGGTGCGGGAACGTTCGGCCATCGAAAATCCATTCGGCTTC
AAGGTGACGGCGTACAGCCGAGATGCGGAGGATACGCCACCTGCTCCACAGCCCGGTGCAGGAGCTGGCC
GATGA
 Primer design