SecReT4
Protein ID: 108524607
T4SS name [ID]Trb [73]
Gene symboltrbC
Locus tagpQKH54_32
StrainPlasmid QKH54
Repliconplasmid QKH54 [GenBank: NC_008055] [Browse all T4SS(s) in this replicon]
Location [Strand]26364..26771 [+]
ProductTrbC prepillin
Component typeTrbC
UniProt IDQ1H9V2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.9e-18, Aligned region: 19..111
Protein Sequence: 135 a.a.     [Download]
>gi|108524607|ref|YP_619829.1| TrbC prepillin [uncultured bacterium]
MYASSQALRTNPQSMFFYVGLALLLAVFLIAPQHAFASEGTGGSLPYESWLTNLRASVTGPVAFALSIIG
IVVAGGVLIFGGDLNGFFRTLIFLVLVMALLVGAQNVMSTFFGRGAEIAAVGEALARSVVSGRIA
 
Nucleotide Sequence: 408 bp     [Download]
>gi|108524577|ref|NC_008055.1|:26364-26771 Uncultured bacterium IncP-1gamma plasmid QKH54 complete genome
ATGTACGCATCTTCTCAAGCACTCCGCACCAACCCTCAGTCGATGTTCTTCTATGTCGGCTTGGCCCTGC
TGCTGGCTGTGTTCCTGATCGCACCCCAGCACGCTTTCGCCTCCGAAGGCACTGGCGGTTCCCTCCCGTA
TGAATCCTGGCTGACCAACCTGCGGGCATCCGTAACTGGCCCGGTAGCCTTCGCGCTGTCGATCATCGGC
ATTGTGGTTGCCGGTGGCGTGCTGATTTTCGGCGGCGACCTGAATGGCTTCTTCCGTACCTTGATCTTCC
TGGTACTGGTTATGGCCCTGCTGGTTGGTGCACAGAACGTCATGTCCACCTTCTTCGGCCGTGGCGCTGA
AATCGCCGCTGTAGGCGAGGCCCTGGCCCGCTCCGTTGTTTCGGGCCGGATCGCCTAA
 Primer design