SecReT4
Protein ID: 108524611
T4SS name [ID]Trb [73]
Gene symboltrbG
Locus tagpQKH54_36
StrainPlasmid QKH54
Repliconplasmid QKH54 [GenBank: NC_008055] [Browse all T4SS(s) in this replicon]
Location [Strand]30368..31258 [+]
ProductTrbG mating pair formation protein
Component typeTrbG
UniProt IDQ1H9U8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6e-63, Aligned region: 70..294
Protein Sequence: 296 a.a.     [Download]
>gi|108524611|ref|YP_619833.1| TrbG mating pair formation protein [uncultured bacterium]
MKLTLSAIALSLAAATAFAAPGDNAADLYFSTNNPTLTQQEKAAIAISQRWQQASATGIKPVDSGDGYVR
FIFGAQQPSIVCAVLQVCDVALQAGEQVNSINLGDTARWTVEPAITGFGPTEVQHLIIKPMDVGLETSLV
VTTNRRTYHFKLRSHRTEYMPQVAFTYPEEALAKWEAIKTRQQAEIKRDTIPQTGEYLGDLNFEYTVTGK
VSWKPVRVYNDGVKTIIEMPKAMSQTEAPTLLVVRKEGGWFKDDETVMVNYRVQSNRFIVDSIFDKAILI
AGVGKSQDRVTIQRGK
 
Nucleotide Sequence: 891 bp     [Download]
>gi|108524577|ref|NC_008055.1|:30368-31258 Uncultured bacterium IncP-1gamma plasmid QKH54 complete genome
ATGAAACTGACCCTTTCCGCAATTGCTCTGAGCCTTGCCGCTGCAACAGCCTTTGCAGCCCCTGGCGACA
ATGCTGCTGACCTGTACTTTTCAACCAACAACCCGACCCTGACCCAGCAAGAAAAAGCGGCTATCGCTAT
TTCTCAGCGCTGGCAGCAGGCGAGCGCAACTGGCATCAAACCAGTGGACTCGGGCGATGGTTATGTTCGT
TTCATCTTCGGGGCGCAGCAGCCGAGCATCGTCTGTGCAGTGCTCCAGGTTTGTGACGTTGCCTTGCAGG
CAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACTGCCCGTTGGACGGTTGAACCAGCGATTACGGG
CTTTGGCCCGACCGAAGTTCAACACCTCATTATCAAACCTATGGACGTGGGCCTGGAAACAAGCCTGGTC
GTCACTACAAATCGCCGTACCTACCACTTCAAGCTGCGCTCGCATCGCACCGAGTACATGCCGCAAGTCG
CCTTCACCTATCCCGAGGAAGCACTGGCGAAGTGGGAAGCGATCAAGACCCGGCAACAGGCTGAAATCAA
GCGCGACACGATCCCTCAGACCGGCGAGTACCTGGGCGACCTGAACTTTGAATACACGGTGACTGGCAAG
GTTTCCTGGAAGCCTGTGCGCGTCTACAACGATGGCGTCAAAACCATCATCGAAATGCCAAAAGCCATGT
CTCAAACCGAGGCCCCGACGCTGCTGGTAGTTCGCAAGGAAGGCGGTTGGTTCAAGGACGATGAAACAGT
GATGGTCAACTACCGCGTGCAGAGCAACCGATTCATCGTCGATTCCATTTTCGATAAGGCCATCCTGATT
GCCGGTGTCGGCAAGTCTCAGGATCGCGTGACCATTCAGCGGGGGAAATAA
 Primer design