SecReT4
Protein ID: 108524616
T4SS name [ID]Trb [73]
Gene symboltrbL
Locus tagpQKH54_41
StrainPlasmid QKH54
Repliconplasmid QKH54 [GenBank: NC_008055] [Browse all T4SS(s) in this replicon]
Location [Strand]34218..35954 [+]
Productputative topoisomerase
Component typeTrbL
UniProt IDQ1H9U3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-37, Aligned region: 64..281
Protein Sequence: 578 a.a.     [Download]
>gi|108524616|ref|YP_619838.1| putative topoisomerase [uncultured bacterium]
MNPTRFVRASWPLLVTLLCVSMDANAAIDSYGLMDDVLQKFKDNASSWAATFEAAATRLFWILATISMVW
TFGMMALRKADIGEFFAEFVRFTIMTGFFWWMLTNGPAFAASIIDSLKQLGGSASALTGFADSFSPSAIV
DIGFIVLGKALSEVSGWSPIDSFIGVVLALAVLILMTLIAINMLLLLVSAWILAYAGIFFLGFGGAKWTS
DMAINYYKTVLGLAAQIMAMILLVGIGKSIIFDYYDNMEEGVVFMEMAVIVVVALVLFVLTNKIPGLISG
IITGASVGGNGIGAFGAGAAVGAVGMAAAAAATGGAAFAAGAANISGGAQALMAAFKGAQSNVAAGSDIT
SRLAGAMGGGGDSGGGGGGSDSGGGSPLASAMGLNSSTSSASSSSSSIGESYSSQASSSSSEGGNSGGAA
SGSDGGSAQSTSADSSSGGSDSSQPASSSSKLATAGKIAADMGANLAAGMGRSAANKAAGIADSAKARIA
DTAGGRLAQEISNPGAASQERRDNQDIAKAESIMSQQDRTEKAEEAREFLAQQSAPSFEGDSIGSAGSNS
DVNAEEEIAAFRDRNQNA
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|108524577|ref|NC_008055.1|:34218-35954 Uncultured bacterium IncP-1gamma plasmid QKH54 complete genome
ATGAACCCAACCCGCTTTGTTCGTGCCTCTTGGCCTCTTCTGGTAACGCTCTTGTGCGTATCAATGGATG
CGAATGCCGCCATTGATAGTTATGGCCTGATGGATGATGTACTCCAGAAATTCAAAGATAACGCCAGTTC
CTGGGCTGCAACCTTTGAAGCGGCCGCAACCCGCCTGTTTTGGATTTTGGCCACAATCTCCATGGTCTGG
ACGTTTGGGATGATGGCGCTGCGCAAAGCGGATATTGGCGAGTTCTTCGCTGAGTTTGTTCGCTTTACCA
TCATGACCGGCTTCTTCTGGTGGATGCTCACAAATGGCCCCGCCTTCGCGGCATCCATTATTGACTCGTT
GAAGCAACTTGGTGGTTCAGCATCGGCTCTGACTGGTTTTGCCGATTCATTCAGCCCATCGGCCATTGTT
GATATTGGCTTTATTGTCTTGGGCAAAGCCCTGTCGGAAGTCTCTGGATGGTCGCCGATAGATAGCTTCA
TCGGCGTGGTACTGGCCCTTGCCGTACTAATCCTGATGACTCTGATTGCGATAAACATGCTGCTCCTGTT
GGTTTCCGCGTGGATTCTGGCTTATGCGGGCATCTTCTTTCTCGGCTTCGGCGGAGCAAAGTGGACTTCC
GACATGGCCATCAACTACTACAAAACCGTCCTTGGGCTAGCAGCCCAAATCATGGCCATGATCCTGCTTG
TCGGTATCGGTAAATCCATAATTTTCGACTACTACGACAACATGGAAGAGGGCGTAGTGTTTATGGAAAT
GGCGGTGATCGTTGTTGTCGCCCTGGTTCTATTCGTACTGACCAACAAGATTCCTGGCCTTATCTCAGGA
ATCATCACTGGTGCCAGTGTCGGCGGAAACGGGATCGGTGCCTTCGGGGCCGGTGCAGCGGTCGGTGCTG
TAGGCATGGCAGCAGCAGCAGCAGCAACGGGCGGCGCAGCATTCGCCGCAGGTGCTGCAAATATCTCAGG
CGGCGCTCAAGCGCTCATGGCTGCCTTTAAAGGCGCACAAAGCAACGTAGCAGCAGGCAGCGATATTACT
TCGCGTCTGGCCGGCGCGATGGGTGGCGGTGGTGATAGCGGCGGCGGTGGCGGCGGTAGTGACTCGGGGG
GTGGCAGTCCTCTCGCTTCCGCAATGGGCCTGAACAGCTCCACATCAAGCGCAAGCTCATCCAGTTCCAG
CATCGGGGAAAGCTACAGCAGCCAAGCCAGCTCCAGTTCCAGCGAAGGCGGAAACAGTGGCGGTGCAGCA
TCTGGCAGTGACGGCGGCAGCGCGCAATCAACCAGCGCTGATAGCAGTAGCGGTGGAAGCGACAGCAGCC
AACCGGCAAGCAGCTCTAGCAAGTTGGCCACGGCAGGCAAGATCGCCGCTGATATGGGCGCGAACCTTGC
GGCCGGCATGGGCCGTTCTGCTGCTAACAAAGCAGCAGGTATTGCTGACTCCGCGAAGGCCCGAATCGCA
GATACAGCCGGTGGACGTTTGGCCCAGGAAATCAGCAACCCTGGCGCAGCATCGCAAGAACGCCGCGACA
ACCAGGACATTGCAAAGGCCGAGTCGATCATGTCTCAGCAAGACCGCACCGAAAAAGCCGAAGAGGCCAG
GGAGTTCCTTGCGCAACAATCTGCCCCATCTTTTGAAGGGGACAGTATTGGAAGTGCAGGTAGCAATAGT
GATGTGAACGCAGAAGAAGAAATTGCTGCGTTCCGTGACCGTAACCAAAACGCATAA
 Primer design