SecReT4
Protein ID: 108562922
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0497
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]514158..515603 [+]
Productcag pathogenicity island protein 3
Component typeCagdelta
UniProt IDQ1CU08
KEGG IDhpa:HPAG1_0497
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|108562922|ref|YP_627238.1| cag pathogenicity island protein 3 [Helicobacter pylori HPAG1]
MFRKLATSVSLIGLLTSNTLCAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNAHTLDKGAAIDENKLFEQQKRA
YFNYANDVICRPNDEVCSPLRDEMVAMPTSDSVTQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALKAELKKKNAKKPRVVE
VPISPKTSNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKSPINPNDLRNLEEEIKSYY
IKSNGLCYANGISLYAKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKNSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|108562424|ref|NC_008086.1|:514158-515603 Helicobacter pylori HPAG1 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCTCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTGTGCTAAAG
AAATAAGTGAAGCCGATAAGGTTATTAAAGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATCACAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGTTGTTTGATATATACGACACCTTGAACGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTATTGGATTACAACAACTA
TTTATCCATAGAAAACCCCATTATCAAAACAAGAGCGATGGGGACTTATGCGGATCTCATCATCATCACA
GGTTCGTTAGAACAAGTCAATGGGTATTACAACATTCTAAAAGCGCTCAACAAACGAAACGCTAAGTTTG
TCCTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTACGAGTGCCAAAAAGAAGCGATCC
TAATGCCCACACGCTTGATAAGGGAGCGGCAATTGATGAAAACAAGCTTTTTGAACAACAAAAACGCGCG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTCGCTATGCCCACTAGCGATAGCGTTACTCAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAGGCCCAACCATCACCTTATGCCACCCAAACCGCTCCTGAAAAT
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTCTAAAAGCAGAGTTGAAAAAGAAAAACGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTTCCCCTAAAACAAGTAATTCTGATGAAACAATGAGAGTTGTTAAAGAAAAAGAAAACTACA
ATGGGTTATTAGTGGATAAAGAAACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGCGAAAATTC
TTACAGCAAAAAATCGCCCATCAACCCTAATGACTTGAGGAACTTAGAAGAAGAAATCAAAAGCTACTAC
ATCAAATCTAACGGCTTGTGTTACGCTAATGGCATCAGCCTCTATGCAAAAATCAAAAACGACCCCTATA
AAGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAATCTGCTCTCACCTCTAAAGGACAAGCTCAAATA
CGACAAACAAAAGTTACAAAAAGCGTTACTGAAAAATTCAAAGTAA
 Primer design