SecReT4
Protein ID: 108562924
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0499
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]516241..518487 [-]
Productcag pathogenicity island protein 5
Component typeCagbeta
UniProt IDQ1CU06
KEGG IDhpa:HPAG1_0499
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-179, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.6e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.9e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|108562924|ref|YP_627240.1| cag pathogenicity island protein 5 [Helicobacter pylori HPAG1]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKTFKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRLPESDDDLFDIWIYAIQDFPNYYFKALCFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNNFKTMGGARETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDAVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c518487-516241 Helicobacter pylori HPAG1 chromosome, complete genome
ATGGAAGACTTTTTATATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTTCTTTACAAATTCATAAAAGCTCAAAAAAAGACTTTTAAAGATAAAGC
TAACCAACCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTGAAAGAAAGAGTTAAAACC
TTTGGCTTTTGGTTACAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTAA
TTCTCTTAGGTAATTTTTATGATGATAATAGATTGCCTGAGAGTGATGATGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTAATTACTATTTTAAGGCGCTTTGTTTTAGTTCACTCAAAATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGGGACATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAAACTGAAGAGAAAATGATCAAAGCCAAGCTCATCACGCCCAACAATAAAAAACGCGCCTTT
GACAAACGAGAGGTGATTGTAGGTAGGCGTGGCTTGGGGGATTTTATCGCTTACGCAGGGCAGGCGTTCA
TTGGCTTGATTGCTCCTACTAGAAGCGGTAAAGGTGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAGGCTGACACTATGGAAACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGCATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTGGCAAAGCTCGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTTTTTAGCAATCAGGCGCGAAACCTTTTTGTCATCAATTGCAATATTT
ACAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCTACGATGTTTTTCATAGGTTCTATGGCAAGCGGGATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTTTAATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGATAATCTAAGAGCACTTA
GTCCTGCCACTAGAAACATGTGGAATAACTTTAAGACAATGGGTGGCGCTAGAGAAACTTATAGCTCGGT
TCAAGGGGTATATACTTCAGCCTTTGCACCTTATAATAACGCCATGATTAGAAATTTCACGAGTGCTAAT
GATTTTGATTTCAGGCGTTTAAGGATCGATGCAGTGAGTATTGGTGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATATTAGAGCTGTTTTTTAACGTGATGATTTATAGCAATTTGATTCTACCAATCCA
TGACCCACAATGCAAAAGAAGTTGCTTGATGCTCATGGATGAATTTACGCTCTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGAATTATGGCAGAATACAACATGCGCCCTGCGTTTGTGTTTCAAAGTAAGGCGC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGGGCTAAAACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGAATCAACAACGATAACTATTATGAACATTTTGAAAAACTTTCTAAGGTGTTAGGG
AAATACACAAGGCAAGATGTGAGCCGAAGCATTGATGACAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATCATTCTAGAGAA
TACGCTCAAACCCATCAAATGCCACAAGGCGCTTTACTATGATGATCCATTCTTCACCGATGAACTCATT
AAGGTGAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACATTCTATGATG
ATTTGCAAGCCGCTAAAACCAGAGGTGAATTGAGCTATGATAAATCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design