SecReT4
Protein ID: 108562927
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0502
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]520227..524114 [-]
Productcag pathogenicity island protein Y
Component typeCagY
UniProt IDQ1CU03
KEGG IDhpa:HPAG1_0502
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 19..51
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 57..89
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 96..128
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 134..166
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 167..195
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 203..235
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 242..274
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 280..312
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 313..341
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 349..381
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 387..419
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 426..458
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 464..496
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 497..525
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 533..565
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 571..603
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 610..641
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 644..669
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 679..711
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 718..749
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 757..791
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 796..823
CagY_M [PF07337], Evalue: 4.6e-282, Aligned region: 845..879
TrbI [PF03743], Evalue: 3.4e-36, Aligned region: 1059..1255
Protein Sequence: 1295 a.a.     [Download]
>gi|108562927|ref|YP_627243.1| cag pathogenicity island protein Y [Helicobacter pylori HPAG1]
MKDLPKDLQKKVLAKKSVKAYLDCVSKARNEKEKKECEKLLTPEARKLLEEAKESLKAYKDCVSKARNEE
ERRACEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYLDCV
SQAKNEAEKKECEKLLTPEAKKLLEQQALDCLKNAKTEADKKRCVKDLPKDLQKKVLAKESLKAYKDCVS
KARNEKEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKNEAEKKECEKLLTPEAKKKLEEAKKSVK
AYLDCVSQAKNEAEKKECEKLLTPEAKKLLEQQALDCLKNAKTDEERKKCLKDLPKDLQKKVLAKKSVKA
YLDCVSKARNEKEKKECEKLLTPEARKLLEEAKESLKAYKDCVSKARNEEERRACEKLLTPEAKKLLEEE
AKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYLDCVSQAKTEADKKECEKLLTPEA
KKLLEQQALDCLKNAKTEADKKRCVKDLPKDLQKKVLAKKSVKAYLDCVSKARNEKEKKECEKLLTPEAR
KLLEEAKESLKAYKDCVSKARNEKEKKECEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKKECEK
LLTPEARKFLAKQVLNCLEKAGNEEERKACLKNLPKDLQENVLAKESLKAYKDCLSQARNEEERRACEKL
LTPEARKLLEQEVKKSVKAYLDCVSKARNEKEKKECEKLLTPEARKFLAKELQQKDKAIKDCLKNADPND
RAAIMKCLDGLSDEEKLKYLQEAREKAVLDCLKTARTDEEKRKCQNLYSDLIQEIQNKRTQNKQNQLSKT
ERLHQASECLDNLDDPTDQEAIEQCLEGLSDSERALILGIKRQADEVDLIYSELRNRKTFDNMAAKGYPL
LPMDFKNGGDIATINATNVDADKIASDNPIYASIEPDITKQYETEKTIKDKNLEAKLAKALGSNKKDDDK
EKSKKSTAESKVESNKIDKDVAETAKNISEIALKNKKEKNGEFVDENGNPIDDKKKAEKQDETSPVKQAF
IGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIM
TRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKL
IGLGKGRSERTPEFNYALGQAINGSMQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYD
VKITNKSVVDEIIKQSTKTLSREHEEITTSPKGGN
 
Nucleotide Sequence: 3888 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c524114-520227 Helicobacter pylori HPAG1 chromosome, complete genome
TTGAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAAAGAGCGTTAAGGCTTATTTGGATT
GCGTTTCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAA
ACTTTTAGAAGAAGCCAAAGAAAGTCTTAAAGCTTATAAAGACTGCGTATCAAAAGCTAGGAATGAAGAA
GAAAGGAGAGCTTGCGAGAAATTGCTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAAGCCAAAGAGA
GCGTTAAAGCTTATTTAGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATT
GCTCACCCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTACTTAGATTGCGTA
TCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAACTACTCACCCCTGAAGCGAAAAAACTTT
TAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGATAAAAAAAGGTGTGTCAAAGA
TCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAGAGAGCCTGAAAGCTTATAAAGACTGCGTATCA
AAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAAAAAACTTTTAG
AAGAAGAAGCCAAAGAGAGCGTTAAAGCTTATTTAGATTGCGTATCTCAAGCCAAAAATGAAGCTGAGAA
AAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAA
GCTTACTTAGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAACTACTCACCC
CTGAAGCGAAAAAACTTTTAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACG
AAAAAAGTGTTTGAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAAAGAGCGTTAAGGCT
TATTTGGATTGCGTTTCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACCCCTG
AAGCGAGAAAACTTTTAGAAGAAGCCAAAGAAAGTCTTAAAGCTTATAAAGACTGCGTATCAAAAGCTAG
GAATGAAGAAGAAAGGAGAGCTTGCGAGAAATTGCTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAA
GCCAAAGAGAGCGTTAAAGCTTATTTAGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAAT
GCGAGAAATTGCTCACCCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTACTT
AGATTGCGTATCTCAAGCCAAAACCGAAGCTGATAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCG
AAAAAACTTTTAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGATAAAAAAAGGT
GTGTCAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAAAGAGCGTTAAGGCTTATTTGGA
TTGCGTTTCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGA
AAACTTTTAGAAGAAGCCAAAGAGAGCCTGAAAGCTTATAAAGACTGCGTATCAAAAGCTAGGAATGAAA
AAGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAA
GAGCGTTAAGGCTTATTTGGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAA
TTGCTCACCCCTGAAGCGAGGAAATTTTTAGCGAAGCAAGTGCTAAATTGTTTGGAAAAAGCTGGAAATG
AAGAAGAAAGAAAAGCATGTCTTAAAAATCTCCCTAAAGACTTACAGGAAAATGTTTTAGCTAAAGAGAG
CCTTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAACTA
CTCACCCCTGAAGCGAGAAAACTTTTAGAGCAAGAAGTTAAGAAGAGCGTTAAGGCTTATTTGGATTGCG
TATCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAGGAAATT
TTTAGCGAAAGAACTCCAACAAAAAGATAAAGCGATCAAAGATTGCTTGAAAAACGCCGATCCTAACGAC
AGAGCGGCTATCATGAAATGTTTGGATGGTTTGAGCGATGAAGAGAAGCTCAAATACCTGCAAGAAGCTA
GAGAAAAGGCTGTCTTGGATTGTTTGAAAACGGCTAGGACCGATGAAGAAAAAAGGAAATGCCAAAACCT
TTATAGCGATTTGATCCAAGAAATCCAAAATAAAAGGACACAAAACAAACAAAATCAATTGAGTAAAACA
GAAAGATTGCATCAAGCAAGCGAGTGCTTGGATAATTTAGATGACCCTACTGATCAAGAGGCCATAGAGC
AATGTTTAGAAGGCTTGAGCGATAGTGAAAGGGCACTAATTCTAGGAATCAAACGACAAGCTGATGAAGT
GGATCTGATTTATAGCGAACTAAGAAACCGCAAAACCTTTGATAACATGGCGGCTAAAGGTTATCCATTG
TTACCAATGGATTTCAAAAATGGCGGCGATATTGCCACTATTAACGCCACTAATGTTGATGCGGACAAAA
TAGCTAGCGATAATCCTATTTATGCTTCCATAGAGCCTGATATTACCAAGCAATACGAAACAGAAAAAAC
CATTAAGGATAAGAATTTAGAAGCTAAATTAGCTAAGGCTTTAGGTAGCAATAAAAAAGATGACGATAAA
GAAAAAAGTAAAAAATCCACAGCAGAATCTAAAGTAGAAAGCAATAAGATAGACAAAGATGTCGCAGAAA
CTGCTAAGAATATCAGTGAAATCGCTCTTAAGAACAAAAAAGAAAAGAATGGGGAATTTGTAGATGAAAA
TGGTAATCCCATTGATGACAAAAAGAAAGCAGAAAAACAAGATGAAACAAGCCCTGTCAAACAGGCCTTT
ATAGGCAAGAGTGATCCCACATTTGTTTTAGCGCAATACACCCCTATTGAAATCACTCTGACTTCTAAAG
TAGATGCCACTCTCACAGGTATAGTGAGTGGGGTTGTAGCCAAAGATGTATGGAATATGAATGGCACTAT
GATCTTACTAGATAAAGGCACTAAGGTGTATGGGAATTATCAAAGCGTGAAAGGTGGCACACCCATTATG
ACACGCTTAATGATAGTCTTTACTAAAGCCATTACGCCTGATGGTGTGATAATACCTCTAGCAAACGCTC
AAGCAGCAGGCATGTTGGGTGAAGCAGGGGTAGATGGCTATGTGAATAACCACTTTATGAAGCGCATAGG
CTTTGCTGTGATAGCAAGCGTGGTTAATAGCTTCTTGCAAACTGCGCCTATCATAGCTCTAGATAAACTC
ATAGGCCTTGGCAAAGGTAGAAGTGAAAGGACACCTGAATTTAATTACGCTTTGGGTCAAGCTATCAATG
GTAGTATGCAAAGTTCAGCGCAGATGTCTAATCAAATTCTAGGACAACTGATGAATATCCCCCCAAGTTT
TTACAAAAATGAGGGCGATAGTATTAAGATTCTCACAATGGACGATATTGATTTTAGCGGCGTGTATGAT
GTTAAAATTACCAACAAATCTGTGGTAGATGAAATCATCAAACAAAGCACCAAAACTTTGTCTAGAGAAC
ATGAAGAAATCACCACAAGCCCCAAAGGTGGCAATTGA
 Primer design