SecReT4
Protein ID: 108562928
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0503
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]524173..526161 [-]
Productcag pathogenicity island protein Y
Component typeCagY
UniProt IDQ1CU02
KEGG IDhpa:HPAG1_0503
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 305..331
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 339..366
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 376..404
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 418..450
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 451..481
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 487..519
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 521..544
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 556..588
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 595..627
CagY_M [PF07337], Evalue: 1.4e-120, Aligned region: 633..661
Protein Sequence: 662 a.a.     [Download]
>gi|108562928|ref|YP_627244.1| cag pathogenicity island protein Y [Helicobacter pylori HPAG1]
MNEENDKLETSKKTQQHSPQDLSNEEATEVNHFEDSLKEESSDNHLNNSTETQTHFDGDKSEETQTQIDS
EGNETSESSNGSLADKLFKKARKLVDNKRPFTQQKNLDEETQELNEEDDQENNGYQEETQTGLIDDETSK
KTQQHSPQDLSNEEATEVNHFEDSLKEESSDNHLDNPTETQTHFDGDKSEEITNDSNDQEIIKGSKKKYI
IGGIVVAVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLF
FNDDPNRTLYNYLNIAEIEDENPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYNDCIKNAKTE
EERIKCLDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERKECLKLINDPEIREKFRKELELQKELQEY
KDCIKNAKTEAEKNECLKGLSKEAIERLKQQALDCLKNAKTDEERNECLKNIPQDLQKELLADMSVKAYK
DCVSKARNEKEKQECEKLLTPEARKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESVKAYKD
CVSQAKTESEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKNEAEKKECEKLLTPEAKKKLEEAKK
SVKAYLDCVSQAKNEAEKKECEKLLTPEAKNF
 
Nucleotide Sequence: 1989 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c526161-524173 Helicobacter pylori HPAG1 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAACCCAACAACATTCACCCCAAGATTTATCTA
ATGAAGAAGCGACAGAAGTCAATCATTTTGAAGATTCTTTAAAAGAAGAAAGCTCAGACAATCATCTTAA
CAACTCCACAGAAACTCAAACCCATTTTGATGGAGACAAGTCAGAAGAAACCCAAACTCAAATAGATTCT
GAAGGTAATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCAGAAAAT
TAGTTGATAATAAAAGACCTTTCACTCAGCAAAAAAATTTAGATGAAGAAACCCAAGAACTGAACGAAGA
AGACGATCAAGAAAATAATGGGTATCAAGAAGAAACTCAAACGGGCTTAATTGATGATGAAACTTCTAAA
AAAACCCAACAACATTCACCCCAAGATTTATCTAATGAAGAAGCGACAGAAGTCAATCATTTTGAAGATT
CTTTAAAAGAAGAAAGCTCAGACAATCATCTTGACAACCCCACAGAAACTCAAACCCATTTTGATGGAGA
CAAGTCAGAAGAAATAACTAACGACTCTAACGATCAAGAGATTATCAAAGGAAGCAAAAAAAAATACATT
ATTGGTGGCATTGTAGTCGCTGTTCTTATCGTGATTATTTTATTTTCTAGAAGCATTTTTCACTACTTCA
TGCCTTTGGAAGATAAAAGCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTCAATGATGAAATCCAAAT
AAGGCAAGAGTATAACCGATTACTGAAAGAACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTC
TTCAACGACGATCCCAATAGAACCTTATACAACTATTTGAATATTGCAGAAATTGAGGACGAAAACCCGT
TGAGAGCCTTTTATGAATGTATTAGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTTATCAAAGACAA
AAAACTTCAAGATCAAATGAAAAAGACTCTAGAGGCTTATAACGACTGCATCAAAAATGCCAAAACTGAA
GAAGAAAGGATCAAGTGTTTAGATTTAATCAAAGATGAAAACTTGAAAAAAAGCTTACTGAACCAACAAA
AAGTTCAAGTGGCTCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGGAAAGAGTGCCTAAAACT
CATAAATGACCCTGAGATTAGAGAGAAATTCCGTAAGGAATTAGAGCTTCAAAAAGAGCTTCAAGAGTAT
AAGGATTGTATCAAAAACGCCAAAACAGAAGCTGAGAAAAACGAATGCTTGAAAGGCTTGTCTAAAGAAG
CTATAGAGAGATTGAAACAGCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAACGA
GTGCTTGAAAAATATTCCCCAAGACTTGCAAAAAGAACTACTAGCTGATATGAGCGTCAAGGCTTACAAG
GATTGCGTATCAAAAGCTAGAAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGA
GGAAAAAGTTAGAACAACAGGTTCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAAAAAGTG
TTTGAAAGATCTCCCTAAAGACTTACAAAGCGATATTTTAGCTAAAGAGAGCGTTAAGGCTTATAAAGAT
TGCGTATCTCAAGCCAAAACCGAATCTGAGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAAAA
AACTTTTAGAAGAAGAAGCCAAAGAGAGCGTTAAAGCTTACTTAGATTGCGTATCTCAAGCCAAAAACGA
AGCTGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAA
AGCGTTAAAGCTTACTTAGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAAC
TACTCACCCCTGAAGCGAAAAACTTTTAG
 Primer design