SecReT4
Protein ID: 108562929
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0504
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]526176..527747 [-]
Productcag pathogenicity island protein X
Component typeCagX
UniProt IDQ1CU01
KEGG IDhpa:HPAG1_0504
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-38, Aligned region: 56..172
CagX [PF03524], Evalue: 2.5e-38, Aligned region: 260..348
CagX [PF03524], Evalue: 2.5e-38, Aligned region: 369..491
Protein Sequence: 523 a.a.     [Download]
>gi|108562929|ref|YP_627245.1| cag pathogenicity island protein X [Helicobacter pylori HPAG1]
MMGQAFFKKIVGCFCLGYLFLSSTIEAAALDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQL
EKDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPK
ELEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSEFIKQQREN
ELDQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKISIKTDKPQKSPEDNSIELSPSDSAWRT
NLVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTA
YINRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEI
FDDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNLGLRWYRVNEIAEKFKLIKDKALVTVIN
KGYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c527747-526176 Helicobacter pylori HPAG1 chromosome, complete genome
TTGATGGGGCAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCA
CAATAGAAGCAGCAGCACTTGACATTAAGAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGAT
TGCTTATTTGGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTT
GAAAAAGATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTA
ATCATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGC
CCTAATGACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCTGACCCTAAA
GAATTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCACAAAAAGCACAAA
AAGATAAAAGAGAAAAAAGAAAAGAAGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGC
TATGAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTTATCAAGCAACAGCGAGAAAAT
GAATTAGACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTG
AAGAACTCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAGGATAAAATTAGTATTAAGAC
AGATAAACCTCAAAAAAGCCCTGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACT
AATCTTGTTGTGCGAACTAATAAAGCCTTGTATCAATTCATTTTGAGGATAGCTCAAAAAGACAATTTTG
CTTCAGCGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTTTCTAGCGTTATTGAAGAGGA
ATTAAAAAAGAGAGAAGAAGCAAAGAGACAGAGAGAATTGATTAAGCAAGAAAATCTTAACACCACAGCC
TACATCAATAGAGTAATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAAC
AAAAAATTATATTAGATCAAGCAAAGGCGCTAGAGACTCAATATGTGCATAATGCCTTAAAAAGAAACCC
CGTGCCTAGAAACTACAATTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATT
TTTGATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTC
AACCTGATGGGAAATTGAGCATGACTGATGCTGCCATTGATCCTAACATGACCAATTTAGGATTGAGATG
GTATAGAGTTAATGAAATTGCAGAAAAGTTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATCAAT
AAAGGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGCGTGA
TTAAAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design