SecReT4
Protein ID: 108562931
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0506
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]529409..530167 [-]
Productcag pathogenicity island protein V
Component typeCagV
UniProt IDQ1CTZ9
KEGG IDhpa:HPAG1_0506
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|108562931|ref|YP_627247.1| cag pathogenicity island protein V [Helicobacter pylori HPAG1]
MLGKKNEEVLVDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALKQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c530167-529409 Helicobacter pylori HPAG1 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAGGAAGTCTTGGTTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACGGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATCGTCAAACGCTCCGATGCTAGACAAATCGTCAATTCTGAAGCTGTTG
TGGATAGTGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAATATTGCGATGTGAGTTTTCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGTTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACACCTGATACAATGGAAAATTATGA
ATATATCACTAAGAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACAGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAAACAATAA
 Primer design