SecReT4
Protein ID: 108562933
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0508
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]531228..532070 [+]
Productcag pathogenicity island protein T
Component typeCagT
UniProt IDQ1CTZ7
KEGG IDhpa:HPAG1_0508
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|108562933|ref|YP_627249.1| cag pathogenicity island protein T [Helicobacter pylori HPAG1]
MKMRASVLTGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNSKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|108562424|ref|NC_008086.1|:531228-532070 Helicobacter pylori HPAG1 chromosome, complete genome
ATGAAAATGAGAGCAAGTGTTTTAACTGGTGCGACAATTCTATGCTTAATTTTAAGCGCATGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAGCTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCATCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATACTTCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCCGA
CATTGATTTTTACTTGCAGCCTACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCCAACAGCAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAAACTCTCTTACAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAAGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design