SecReT4
Protein ID: 108562937
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0512
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]534882..536012 [+]
Productcag pathogenicity island protein M
Component typeCagM
UniProt IDQ1CTZ3
KEGG IDhpa:HPAG1_0512
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|108562937|ref|YP_627253.1| cag pathogenicity island protein M [Helicobacter pylori HPAG1]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYKKLLPNPYAYVLNQETFT
KEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|108562424|ref|NC_008086.1|:534882-536012 Helicobacter pylori HPAG1 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTATGGATCATAGAGCTAAAGTTCTTTCAGACTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATCTAGAGCAAGCCTTAAA
AGATAACCCTCTCTATAAGAAACTCCTCCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAAGGAGCGTTTGAGTTATTACTACCCCCAGGTGAAAACGAGCAGTATTTTTAAAAAAACCA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTCTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
CTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAATAAGTTTGACTCCA
AAGCAAAAGATATTGCTCAAAAGGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATTAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAATTTTACCAATCAAAAATTGAGTTTCGCACAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design