SecReT4
Protein ID: 108562938
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0513
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]536027..536947 [+]
Productcag pathogenicity island protein N
Component typeCagN
UniProt IDQ1CTZ2
KEGG IDhpa:HPAG1_0513
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|108562938|ref|YP_627254.1| cag pathogenicity island protein N [Helicobacter pylori HPAG1]
MKSIFKKLGSVALYSLVVYGGLNAINTALLPSEYKKLVALGFKKIKTFHQRHDDEEITKEEKEFATNALR
EKLRNDRARVEQIQKNIEAFEKKNNPSIQKKAAKHKGLQELNEINAHPLNGNPNSNSSAETKSNKDDNFD
EMINKVNEAFVKPAAPLVPDKWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILTPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSNNRTFLIASCAICEKKKKEMEQENNYQDTTNASEFGATDTKENEAKDAAF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|108562424|ref|NC_008086.1|:536027-536947 Helicobacter pylori HPAG1 chromosome, complete genome
TTGAAAAGCATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTCTTTAGTTGTTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTGCCGAGTGAATACAAAAAATTAGTGGCTTTAGGCTTTAAAAAAATCAAAAC
ATTCCATCAAAGACATGACGACGAAGAAATTACAAAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGAAATGATAGGGCGAGAGTAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACCCTTCTATTCAAAAAAAAGCGGCTAAGCACAAAGGATTACAAGAATTAAACGAAATTAACGCTCA
CCCTTTGAATGGCAACCCTAATAGCAATTCTTCCGCTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGAAGCTTTTGTAAAACCTGCTGCTCCGCTTGTGCCTGATAAATGGAGAA
CACCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTACGATGGGTTAAGAAAGTG
TTTGATCAAAGGCATCAAGGATCAAAAAATTCTTACCCCCTTATTAGAAAAAATTCAAGAAATAGAGACA
GAAAATAACAAATTTTCTAGACAACACTTGAGTGGTTTAAAACTCGCTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCGTGCGCGATTTGTGAGAAGAAAAAAAAAGAAATGGAGCAAGAAAATAACTATCA
AGATACTACAAATGCAAGTGAGTTTGGAGCTACTGATACAAAAGAAAATGAAGCAAAAGATGCAGCGTTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
GAAAAAAATAG
 Primer design