SecReT4
Protein ID: 108562939
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0514
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]537029..537742 [-]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDQ1CTZ1
KEGG IDhpa:HPAG1_0514
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|108562939|ref|YP_627255.1| cag pathogenicity island protein L [Helicobacter pylori HPAG1]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDSTYKETNQQVLKNLDEIFSTTSPSANNEIGQEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c537742-537029 Helicobacter pylori HPAG1 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGTTTAAAGCAACTGGATAGCACCTACAAAGAAACCAACCAACAAGTGCTCAAAAACCTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATAATGAAATAGGTCAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGGGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTCAAAACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAATACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAA
GGGAAACTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCCCTAAAGGCGTATC
AGAGCAACATTGGAGGTACAGCTTCTTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAAAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGGAA
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTTAAATGA
 Primer design