SecReT4
Protein ID: 108562942
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0517
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]540024..540452 [-]
Productcag pathogenicity island protein G
Component typeCagG
UniProt IDQ1CTY8
KEGG IDhpa:HPAG1_0517
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|108562942|ref|YP_627258.1| cag pathogenicity island protein G [Helicobacter pylori HPAG1]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c540452-540024 Helicobacter pylori HPAG1 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACTGATATAAAAGATATTAGTCCTGAAGATATGGCGCTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAAAATGTTAATATCAAATTTGACGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGCATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGCTATGCGCCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design