SecReT4
Protein ID: 108562946
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_0521
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]544274..544924 [-]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDQ1CTY4
KEGG IDhpa:HPAG1_0521
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 216 a.a.     [Download]
>gi|108562946|ref|YP_627262.1| cag pathogenicity island protein D [Helicobacter pylori HPAG1]
MAKVEELAKLINNNSSKKLRGFFLKVLLSLVVFSSYGLANDDKEAKKEALEKEKNTPNGLVYTNLDFDSF
KATIKNLKDKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINP
EVKDFFTFKSISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTIT
CEAVYL
 
Nucleotide Sequence: 651 bp     [Download]
>gi|108562424|ref|NC_008086.1|:c544924-544274 Helicobacter pylori HPAG1 chromosome, complete genome
TTGGCGAAAGTGGAGGAGCTAGCTAAATTGATCAACAATAATAGTAGTAAAAAACTGAGAGGCTTTTTTT
TGAAAGTTCTCTTAAGTCTCGTTGTTTTCAGTTCGTATGGGTTAGCAAATGACGATAAAGAAGCCAAAAA
AGAAGCGCTAGAAAAAGAAAAAAACACTCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTT
AAAGCGACTATCAAAAATTTGAAAGACAAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAG
ATGAAGTTTTTGACTTCGTGATTGTCAATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCC
AATCATTGAAAAAATCTTTGATGAAAAGGGTAAAGAAATGGGATTGAATGTAGAATTACAGATCAATCCT
GAAGTGAAAGACTTTTTTACTTTCAAAAGCATCAGCACGACCAACAAACAACGTTGCTTTCTGTCATTAC
GCGGAGAAACAAGAGAAATTTTATGCGATGATAAGCTATATAATGTTTTATTGGCCGTATTCAATTCTTA
TGATCCTAATGATCTTTTGAAACATATTAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACA
TGTGAAGCGGTATATCTATAA
 Primer design