SecReT4
Protein ID: 108563807
T4SS name [ID]Cag [37]
Gene symbol-
Locus tagHPAG1_1382
StrainHelicobacter pylori HPAG1
Repliconchromosome [GenBank: NC_008086] [Browse all T4SS(s) in this replicon]
Location [Strand]1431707..1432237 [+]
ProductcagY like protein
Component typeCagY
UniProt IDQ1CRH3
KEGG IDhpa:HPAG1_1382
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 7.8e-16, Aligned region: 41..72
Protein Sequence: 176 a.a.     [Download]
>gi|108563807|ref|YP_628123.1| cagY like protein [Helicobacter pylori HPAG1]
MSFASKMIAKVSNGMCFLPSYLLEPYEKLLTPEARKLLEQQALDCLKNAKTEADRKECVKNLPKNLRKEI
LDKNSLEAYKTPQKSRTNPLKKETPKLLNSGELWLIHYFSIEKTTLNPLKEILMYNTNQEFLPCFLRMIN
PFNRDLPHIVTMGRDEILQQTPLKSHLIKNKAFLKH
 
Nucleotide Sequence: 531 bp     [Download]
>gi|108562424|ref|NC_008086.1|:1431707-1432237 Helicobacter pylori HPAG1 chromosome, complete genome
TTGTCGTTTGCTTCCAAAATGATCGCAAAAGTGTCTAATGGAATGTGTTTTTTGCCAAGCTATCTCTTAG
AGCCATATGAGAAACTGCTCACGCCTGAAGCTAGGAAACTTTTGGAACAACAGGCTCTAGATTGTTTGAA
AAACGCCAAAACTGAAGCCGACAGAAAAGAATGTGTCAAAAACCTCCCCAAAAACTTGAGAAAAGAGATT
TTAGATAAAAACAGCTTAGAAGCCTATAAAACGCCCCAAAAGTCAAGGACAAACCCGCTTAAAAAGGAAA
CCCCTAAGCTTTTAAACTCAGGGGAACTTTGGCTAATACATTACTTTTCTATAGAAAAGACCACTTTAAA
CCCCTTAAAAGAGATTTTAATGTATAATACTAACCAAGAGTTTTTACCATGTTTTCTTCGCATGATAAAC
CCTTTTAACCGTGATTTGCCCCATATCGTAACTATGGGGCGTGATGAAATCCTACAACAAACCCCCTTAA
AATCTCATCTAATCAAAAACAAGGCGTTTTTAAAACATTAA
 Primer design