SecReT4
Protein ID: 10954432
T4SS name [ID]MagB [453]
Gene symbolmagB14
Locus tagpVT745_p23
StrainAggregatibacter actinomycetemcomitans plasmid pVT745 (NC_002579)
Repliconplasmid pVT745 [GenBank: NC_002579] [Browse all T4SS(s) in this replicon]
Location [Strand]13224..13556 [-]
Producthypothetical protein
Component typeMagB14
UniProt IDQ9F256
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbM [PF07424], Evalue: 7.8e-26, Aligned region: 27..99
Protein Sequence: 110 a.a.     [Download]
>gi|10954432|ref|NP_067570.1| unknown [Aggregatibacter actinomycetemcomitans]
MKKPFKIGVIFLALCSMSQISHAVDELTGDTKTACEALLCLSSPKDAAKTPECHPPLNKFYSIRAKKPHE
TLKKRRNFLKLCPDSNEDSINQALSSKCARKPFSRKCIFK
 
Nucleotide Sequence: 333 bp     [Download]
>gi|10954409|ref|NC_002579.1|:c13556-13224 Aggregatibacter actinomycetemcomitans plasmid pVT745, complete sequence
ATGAAAAAGCCCTTTAAAATTGGTGTAATCTTTCTTGCTTTATGCAGTATGAGCCAAATAAGCCATGCGG
TGGATGAATTAACCGGTGATACAAAAACCGCCTGTGAAGCTCTACTCTGCTTATCATCACCAAAAGACGC
GGCGAAAACGCCGGAATGTCATCCGCCGTTAAATAAGTTCTATTCAATTCGGGCTAAAAAACCACACGAA
ACATTAAAGAAACGTCGTAATTTTTTAAAATTGTGTCCGGATTCTAACGAGGACTCTATTAATCAAGCGT
TATCGAGCAAATGCGCCCGCAAGCCGTTCAGTCGAAAATGTATATTTAAATAA
 Primer design