SecReT4
Protein ID: 10954768
T4SS name [ID]Trb [299]
Gene symbolriorf122
Locus tagpRi1724_p123
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]151249..152061 [-]
Producthypothetical protein
Component typeTrbG
UniProt IDQ9F5D0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-56, Aligned region: 57..268
Protein Sequence: 270 a.a.     [Download]
>gi|10954768|ref|NP_066703.1| riorf122 [Agrobacterium rhizogenes]
MQKTGLIAAAGCMAGLAFVVGAQAQSMTSNEVKGTNISRKWRGTPGLVTTGPDGKVIFLFGETQPSVVCS
PLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGATGGQAIHLIVKPSEPGLLTSMVVTTSRRTYHVQLK
SHPSQYMARVGFEYPEDVSTKLADINARLETGGIPGTAPDKLNFSYSVNGSAPWRPKRVYSDGVKTYIQF
PKSISGQDAPVLFVVSGGQNRIVNYRMTNDMMTVDYAIDKAILVSGVGWRQQKITIRRGG
 
Nucleotide Sequence: 813 bp     [Download]
>gi|10954646|ref|NC_002575.1|:c152061-151249 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGCAAAAGACAGGACTGATCGCAGCCGCCGGCTGCATGGCCGGACTCGCCTTTGTCGTGGGCGCGCAGG
CGCAAAGCATGACGAGCAACGAGGTCAAGGGCACGAATATCTCCCGGAAATGGCGCGGCACACCGGGCCT
GGTCACGACTGGGCCGGACGGCAAAGTGATCTTTCTATTCGGCGAGACCCAGCCATCCGTCGTCTGCTCG
CCGTTGCAAGTCTGTGATATCGAGCTTCAGGGCGGTGAGATCGTTCGTGACGTCTTGGTCGGCGACACCG
TGCGCTGGAAGGTGGAGCCGGCCACTTCGGGGGCGACAGGTGGGCAGGCAATCCACCTGATCGTCAAACC
ATCTGAGCCCGGCCTTCTCACCTCGATGGTCGTCACCACGTCACGGCGAACCTATCATGTCCAGCTCAAG
TCCCATCCCAGCCAGTACATGGCGCGTGTCGGGTTCGAATATCCGGAGGATGTGTCGACCAAGCTCGCCG
ACATCAATGCCCGTCTCGAAACCGGCGGCATTCCCGGCACCGCGCCAGACAAGCTGAACTTTTCCTACTC
CGTAAACGGCAGCGCCCCCTGGAGGCCGAAGCGGGTCTATTCGGACGGGGTGAAGACCTACATCCAGTTC
CCGAAGTCGATCTCCGGCCAGGATGCACCTGTGCTGTTTGTTGTGTCTGGTGGCCAGAACCGCATCGTCA
ATTATCGCATGACGAACGACATGATGACCGTCGACTATGCGATCGACAAGGCGATCCTTGTTTCCGGAGT
CGGTTGGCGGCAGCAGAAGATCACCATCCGGCGGGGAGGCTGA
 Primer design