SecReT4
Protein ID: 10954770
T4SS name [ID]Trb [299]
Gene symbolriorf124
Locus tagpRi1724_p125
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]152761..153942 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDQ9F5C8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-32, Aligned region: 62..276
Protein Sequence: 393 a.a.     [Download]
>gi|10954770|ref|NP_066705.1| riorf124 [Agrobacterium rhizogenes]
MVKATVARSFLIAGLFFLGYVAPAFAQEGQVLTELENQVSAAAKGWETTIMDAAKSLFWILATIEIGIAA
VWLAIQSASLDSWFAELVRRIMFVGFFAFVLTQGPTFARAVVDSLFQIGAGGGSASPAEVFDAGIRVASQ
MSQQAQFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAVRY
LVYAFGVGMKLMALVMIAKIGSQVLLGLANAPTASSDQFVTTLAIAGISVVVFIIAMYVPNIIQGVVQGA
SVTGGMETIRHGGQAASFAAGAGFLAAGAAGAGFAAAQAARAGGSSVAGAALRGIGASFSSGAQAAGLAA
KEKAIGSPGAYAGSILGLANAKLDEQRSGHSGPKPPPERNDKP
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|10954646|ref|NC_002575.1|:c153942-152761 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGGTGAAGGCAACTGTTGCACGTTCATTCCTGATTGCAGGTCTCTTTTTCCTCGGCTATGTTGCACCCG
CTTTCGCGCAGGAGGGGCAGGTTCTCACGGAACTGGAAAACCAGGTCTCTGCCGCCGCGAAAGGGTGGGA
GACCACCATCATGGATGCGGCGAAGTCCCTATTCTGGATTCTCGCAACGATCGAGATCGGCATTGCAGCC
GTCTGGCTGGCGATCCAGTCAGCCTCCCTGGACAGCTGGTTCGCTGAACTGGTGCGGCGGATCATGTTCG
TCGGGTTCTTCGCATTCGTTCTGACCCAAGGTCCGACCTTTGCGCGGGCGGTGGTCGACAGCCTTTTCCA
AATTGGCGCCGGCGGCGGTTCAGCTTCGCCCGCCGAAGTGTTCGATGCCGGCATCCGCGTCGCCTCGCAA
ATGTCGCAACAGGCGCAGTTCGGTGTGTTCGAGGATAACGCCCTCGCGATCGCCGCCGTTCTCGCCATGG
GCGTCGTGGTCATATGCTTCTCGCTCGTCGCCGCAATTTTCGTATCGGTGATGGTGGAGATGTATGTCGG
CTTGCTCGCCGGCATGATCATGCTCGGCCTGGGCGGTTCTTCCTTCACCAAGGACTTTGCTGTTCGCTAT
CTTGTGTACGCCTTCGGCGTCGGCATGAAACTGATGGCGCTGGTGATGATTGCAAAGATCGGGTCACAGG
TCCTCTTGGGTCTGGCCAATGCCCCGACCGCATCCTCGGACCAGTTTGTCACCACCCTGGCCATCGCCGG
TATTTCCGTCGTGGTCTTCATCATCGCTATGTACGTGCCGAACATCATCCAGGGTGTCGTCCAGGGTGCT
TCCGTCACCGGCGGTATGGAGACAATCCGCCACGGCGGGCAGGCCGCGTCATTCGCCGCGGGCGCTGGAT
TCTTGGCCGCCGGCGCTGCCGGCGCGGGTTTTGCAGCGGCCCAAGCCGCACGAGCTGGCGGTTCATCCGT
CGCCGGTGCTGCCCTGCGGGGGATAGGCGCAAGCTTCAGTTCCGGCGCACAAGCCGCAGGCTTGGCCGCC
AAGGAAAAGGCAATCGGATCTCCCGGTGCCTATGCGGGGTCCATCCTCGGACTAGCCAACGCCAAGCTCG
ATGAACAGCGCAGCGGTCACAGCGGCCCGAAGCCTCCTCCCGAACGCAACGACAAACCATAA
 Primer design