SecReT4
Protein ID: 10954775
T4SS name [ID]Trb [299]
Gene symbolriorf129
Locus tagpRi1724_p130
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]157661..158044 [-]
Producthypothetical protein
Component typeTrbC
UniProt IDQ9F5C3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-20, Aligned region: 3..99
Protein Sequence: 127 a.a.     [Download]
>gi|10954775|ref|NP_066710.1| riorf129 [Agrobacterium rhizogenes]
MSRKHALIAAALLAAPIVFASVAPALASSGGSLPWEGPLQQIQESITGPVAGAIALAAVAIAGGMLIFGG
ELNDFARRLVYVVLVAGILLGATNIVGLFGATGASIGLTSEQLTTIDSTKGGEGTHG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|10954646|ref|NC_002575.1|:c158044-157661 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGTCGCGTAAGCATGCACTCATCGCCGCCGCGCTTCTGGCGGCGCCTATTGTTTTCGCCTCCGTCGCGC
CAGCGCTCGCCAGTTCCGGCGGCAGTCTCCCATGGGAAGGGCCGCTACAACAGATCCAGGAGTCCATCAC
CGGCCCAGTTGCGGGTGCAATCGCGCTTGCGGCCGTGGCCATAGCCGGCGGCATGCTCATCTTCGGCGGC
GAGCTGAACGATTTCGCCCGGCGGCTTGTCTATGTCGTTCTCGTCGCAGGCATCCTGCTCGGCGCCACCA
ACATCGTCGGCCTGTTCGGCGCAACCGGCGCCTCGATAGGGCTAACGAGCGAACAGCTCACCACGATCGA
CTCGACAAAAGGAGGGGAGGGCACTCATGGCTAA
 Primer design