SecReT4
Protein ID: 10954805
T4SS name [ID]VirB [20]
Gene symbolriorf159
Locus tagpRi1724_p160
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]198325..198492 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDQ9F596
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|10954805|ref|NP_066740.1| riorf159 [Agrobacterium rhizogenes]
MKYFLLFLIIGLASCQTSDQLATCKGPIFPLNVGRWQPAQSDLQPTNAGEANERL
 
Nucleotide Sequence: 168 bp     [Download]
>gi|10954646|ref|NC_002575.1|:198325-198492 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
TTGAAGTACTTTCTATTGTTTTTGATCATCGGCTTGGCGTCTTGTCAGACAAGCGATCAGTTGGCGACTT
GTAAGGGGCCTATTTTTCCGCTGAACGTCGGGCGATGGCAGCCTGCTCAGTCGGACCTTCAGCCTACCAA
CGCAGGAGAGGCTAATGAACGGCTCTGA
 Primer design