SecReT4
Protein ID: 10954806
T4SS name [ID]VirB [20]
Gene symbolriorf160
Locus tagpRi1724_p161
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]198479..199192 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDQ9F595
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.7e-41, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|10954806|ref|NP_066741.1| riorf160 [Agrobacterium rhizogenes]
MNGSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAVIAVAGNVAQAFAIAVMLPLNKLVPV
YLWVRPDGTVDSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDLVSSFSAPTVRQDYQQFF
NYPSPSSPQTIIGKRGKLEAEHIGSNELMPGVQQIRYKRTLIMEGQAPIVTTWTATVHYETVTNLPGRLR
LTNPGGLIVTSYQTSEDTVSNTTRSQQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|10954646|ref|NC_002575.1|:198479-199192 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGAACGGCTCTGAATACGCGCTGTTAGTAGAGCGGGAAGCATTGGCGGACCACTATAAGGAAGTAGAAG
CATTTCAGTCTGCACGTGCTAGATCAGCTCGGCGAATCTCTAGAGCCTTGGCTGCTTTGGCTGTCATTGC
AGTCGCAGGAAACGTGGCGCAGGCCTTCGCTATCGCCGTCATGCTTCCGCTGAACAAACTTGTTCCAGTA
TATCTGTGGGTGCGCCCAGACGGTACAGTTGACAGTGAGGTATCTATTTCGCGGTTGCCGGCGACGCAGG
AGCAAGCGGTCGTGAATGCGTCTCTATGGGAGTATGTTCGTCTGCGGGAGAGCTACTCGGCGGATACAGC
CCAATACGCCTATGATCTGGTCTCGAGCTTCAGTGCCCCAACGGTGCGTCAAGATTATCAGCAGTTCTTC
AATTACCCCAGTCCTAGCTCCCCCCAAACCATCATTGGTAAGCGCGGAAAGCTGGAAGCCGAGCACATCG
GCTCGAACGAACTTATGCCTGGCGTCCAGCAGATCCGCTACAAACGCACTCTCATCATGGAAGGGCAAGC
TCCAATAGTAACCACCTGGACCGCAACGGTACATTATGAAACGGTAACTAACTTGCCCGGCCGATTGAGG
CTGACAAATCCAGGCGGCTTAATCGTTACCTCCTATCAAACTTCGGAAGATACCGTTTCGAACACGACGC
GGAGCCAGCAATGA
 Primer design