SecReT4
Protein ID: 10954809
T4SS name [ID]VirB [20]
Gene symbolriorf163
Locus tagpRi1724_p164
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]201231..202265 [+]
Producthypothetical protein
Component typeVirB11
UniProt IDQ9F592
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-59, Aligned region: 13..310
Protein Sequence: 344 a.a.     [Download]
>gi|10954809|ref|NP_066744.1| riorf163 [Agrobacterium rhizogenes]
MEVNPQLRALLNPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSYDDLEDIAILAGALRKQDVG
PRNPLCATELPGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDVRRWNQWQIRTQRRDQLDE
AILRDYDNGDLESFLRACVIGKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVR
LLYSKSGAGLGAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSVQGASLEDRTLIDMLATAIDVIVPFRAYGDVYEVGEVWLAADARRRGETIGDLLNQQ
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|10954646|ref|NC_002575.1|:201231-202265 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGGAAGTAAATCCGCAATTGCGCGCCCTTCTTAACCCAGTCTTGCAATGGCTCGATGACCCGAGGACTG
AAGAAGTTGCCATAAACGGACCGGGAGAAGCCTTTGTACGCCAAAGTGGCGTCTTCACGAGGTTCGCCGC
ACCGTTCTCTTATGATGATCTCGAAGACATCGCCATTCTAGCAGGGGCATTGCGAAAACAAGATGTCGGC
CCCCGCAACCCTCTTTGCGCTACCGAGCTCCCAGGTGGCGAGCGGATGCAAATCTGCTTGCCGCCAACGG
TACCCTCTGGCACCGTGAGCTTGACAATTCGACGACCGAGCAATCGTGTCTCTGAATTGGGGGAAGTCTC
GGCTCGCTACGATGTTCGTCGATGGAATCAGTGGCAAATCCGGACGCAGCGACGAGATCAACTAGACGAA
GCGATTCTGCGCGACTACGACAATGGCGATCTGGAATCATTTTTACGTGCATGTGTTATCGGTAAGCGGA
CGATGTTGCTTTGTGGGCCGACCGGAAGCGGCAAGACCACGATGAGCAAGACCTTGATCAGTGCTATTCC
GCGGGAAGAAAGGCTGATAACCATTGAAGATACGCTCGAACTCGTCATTCCACATGAGAACCACGTCAGA
CTGCTCTACTCCAAGAGTGGGGCAGGGCTAGGTGCAGTGACTGCGGAACAGCTGCTCCAGGCAAGCCTTC
GGATGCGGCCTGACCGAATATTGCTCGGTGAGATGCGCGACGACGCGGCGTGGGCGTACCTGAGTGAGGT
GGTCTCAGGCCACCCCGGATCGATTTCAACCATACATGGGGCGAATCCCGTCCAAGGCTTCAAAAAGCTG
TTCTCACTTGTGAAGAGCAGTGTGCAGGGGGCAAGCTTGGAAGATCGCACACTGATTGACATGTTGGCAA
CGGCAATCGATGTCATTGTTCCCTTCCGTGCTTACGGCGATGTTTACGAAGTGGGCGAAGTATGGCTCGC
CGCCGATGCCCGCCGACGCGGTGAGACGATAGGGGATCTTCTAAACCAGCAATAG
 Primer design