SecReT4
Protein ID: 10954816
T4SS name [ID]VirB [20]
Gene symbolriorf170
Locus tagpRi1724_p171
StrainAgrobacterium rhizogenes plasmid pRi1724 (NC_002575)
Repliconplasmid pRi1724 [GenBank: NC_002575] [Browse all T4SS(s) in this replicon]
Location [Strand]210487..212469 [+]
Producthypothetical protein
Component typeVirD4
UniProt IDQ9F585
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.4e-155, Aligned region: 97..537
TraG-D_C [PF12696], Evalue: 1.4e-27, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 2.2e-23, Aligned region: 138..521
AAA_10 [PF12846], Evalue: 4.8e-07, Aligned region: 140..467
Protein Sequence: 660 a.a.     [Download]
>gi|10954816|ref|NP_066751.1| riorf170 [Agrobacterium rhizogenes]
MNSGKYTPIGLAASIACSLAVGFCAASLYVTFRHGFTGETMMTFNVFAFLYETPPYLGYASPTFYRGLAI
IVATSTLVLLCQLLLSMREREHHGTARWAGSGEMRHAGYLRRYSHVTGPIFGKTCGPRWFGSYLSNGEQP
HSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKSSGDAVFKFSPLDPERRTHCYNPV
LDIAALPPERRFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILSCIERGTPTIGAVYDLFAQPGEKY
KLFAQLAEETQNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSTSDFSVYDLRRKRTC
IYLCVSPNDLEVIAPLMRLLFQQVVSILQRSLPLGDERHEVLFLLDEFKHLGKLEAVETAITTIAGYKGR
FMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPNYISKAIGDYTFQARSTSYSQARMFDHNI
QISDQGAPLLRAEQVRLLDDDYEIVLIKGQPPLKLRKVRYYSDLILKRIFESQHGSLPEPASLMLPGDTN
LVEGKLDQGTADTTSQKPVQIEENDHGEVVSPQNRTVADGVMPIEVRPRSNEVDDEREYQGADAATSEKL
PEIAPALLAQRELLDQIISLQLRGRTASGT
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|10954646|ref|NC_002575.1|:210487-212469 Agrobacterium rhizogenes plasmid pRi1724 DNA, complete sequence
ATGAATTCAGGCAAGTACACGCCAATAGGCCTGGCTGCGAGCATAGCATGTTCACTGGCCGTGGGGTTTT
GTGCGGCCAGTCTCTATGTCACATTTCGCCATGGCTTTACGGGCGAAACGATGATGACTTTCAACGTTTT
TGCGTTCCTGTACGAGACACCGCCTTATTTGGGATACGCAAGTCCTACGTTCTATCGCGGACTAGCCATC
ATCGTTGCGACGTCAACGCTCGTGTTGCTATGCCAACTACTGTTATCGATGCGCGAGCGCGAACATCACG
GCACTGCTCGCTGGGCCGGCTCCGGCGAGATGCGGCACGCCGGGTACCTCCGGCGCTACAGTCACGTCAC
GGGTCCCATCTTCGGCAAGACATGTGGACCACGTTGGTTTGGCAGCTACCTAAGTAACGGAGAACAACCT
CACAGCCTTGTTGTCGCGCCAACTCGCGCTGGTAAGGGTGTCGGCGTCGTTATCCCGACGTTGCTAACCT
TCAAGGGCTCAGTAATTGCTCTGGATGTGAAAGGCGAGCTATTTGAACTCACATCGAGGGCGCGTAAATC
AAGTGGTGACGCGGTTTTCAAGTTCTCGCCCTTAGATCCAGAGCGGCGAACGCATTGTTACAATCCCGTG
CTGGATATTGCCGCGTTGCCGCCCGAACGGCGCTTTACAGAAACGCGCCGCCTCGCTGCGAATCTCATCA
CCGCCAAAGGCAAGGGAGCCGAAGGTTTCATCGACGGGGCACGGGATCTTTTCGTAGCAGGCATATTGAG
TTGCATTGAGCGCGGCACACCAACGATCGGTGCCGTTTACGATCTGTTTGCTCAGCCGGGTGAAAAGTAC
AAACTATTTGCGCAACTCGCGGAGGAAACACAAAACAAAGAGGCTCAGCGTATCTTCGACAATATGGCGG
GGAATGACACCAAAATCCTGACATCCTACACATCGGTGCTCGGCGACGGCGGACTCAATCTTTGGGCCGA
TCCACTCGTTAAAGCGGCTACAAGCACCTCGGATTTTTCCGTCTACGATCTGCGGCGGAAGAGGACTTGT
ATTTATCTTTGTGTCAGCCCGAACGATCTCGAAGTCATAGCGCCCTTGATGCGTCTTCTCTTCCAGCAGG
TTGTATCAATCCTGCAGCGATCGCTGCCACTTGGAGATGAACGGCACGAAGTTCTGTTTCTCCTCGATGA
GTTCAAGCACTTGGGCAAGCTGGAAGCTGTGGAGACGGCAATTACGACGATCGCCGGCTACAAGGGCCGC
TTCATGTTTATTATTCAGAGTCTTTCGGCTTTGACAGGAACTTATGATGAAGCTGGTAAGCAAAATTTTC
TCAGCAATACGGGTGTGCAGGTATTCATGGCGACTGCTGATGACGAGACGCCCAACTACATTTCCAAAGC
TATCGGCGACTACACATTCCAGGCTCGCTCAACGTCGTACAGCCAAGCGCGCATGTTTGATCATAACATC
CAAATCTCCGACCAAGGAGCACCGCTTTTGCGCGCCGAACAAGTCCGCCTACTCGACGACGATTATGAAA
TAGTCCTTATCAAAGGCCAACCTCCCCTCAAACTGAGAAAAGTGCGATATTATTCGGATCTCATATTGAA
GCGAATTTTCGAAAGCCAACACGGTTCCCTTCCCGAGCCCGCATCTTTGATGTTGCCGGGAGACACAAAC
CTCGTTGAAGGCAAGCTCGACCAGGGAACAGCCGATACAACTTCGCAAAAGCCGGTGCAGATTGAAGAGA
ACGACCATGGGGAAGTCGTTTCCCCCCAAAACAGAACTGTGGCTGATGGAGTAATGCCAATAGAAGTTCG
TCCCCGTTCAAACGAAGTTGATGACGAGCGGGAATACCAAGGCGCGGACGCCGCAACCTCTGAGAAGCTT
CCGGAAATTGCTCCGGCTCTTTTGGCGCAGCGCGAACTCCTCGACCAGATCATTTCGCTCCAGCTGCGAG
GTAGAACAGCTTCCGGCACTTGA
 Primer design