SecReT4
Protein ID: 10954827
T4SS name [ID]Trb [244]
Gene symboltiorf7
Locus tagpTi-SAKURA_p008
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]7308..8624 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDO66179
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.6e-64, Aligned region: 249..433
Protein Sequence: 438 a.a.     [Download]
>gi|10954827|ref|NP_053247.1| hypothetical protein pTi-SAKURA_p008 [Agrobacterium tumefaciens]
MIQSLKLGGTAQEEEALSGMRRINRLPIIIVVVLVVAFLGVIFYGLTSRGLYFRGDEGPDTSSGNPASTF
ADQIKRGVSDGIIGEPQLVTTLQPTPVETQEEKRAVNPFTPQPGRREEARPEAQLESEQVWRARLQREQE
EQYLRERQRQRMARLQANDAAYDSPIAVDRDKFAGRGADTAAMASATTNGVSTATTSGASDLYAAALRAG
LGGQNGDPNGQKSKEDFFNADLKELGYLPNRVVPQQSIYELKRGSVIPATLITGINSDLPGRITAQVSQN
VYDSATGHRLLIPQGTKLFGRYDSKVSFGQSRVLVVWTDIIFPNGSTLQIGGMAGTDAQGYSGSRDKVDR
KWLQTFGSAILIAVIGTGIDMAVPESSTLATQDTASDAARRNFAETFGRVADRTIQRNMDVQPTLEIRPG
YKFNVLVDQDIVFPGTYR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c8624-7308 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGATTCAGTCGCTCAAGCTTGGCGGTACTGCCCAAGAAGAGGAGGCACTCTCCGGCATGCGCCGGATCA
ACCGCCTGCCAATCATCATCGTGGTCGTGCTGGTTGTCGCCTTCCTGGGCGTCATCTTTTATGGTCTAAC
CTCGCGTGGTCTGTATTTTCGGGGGGACGAAGGTCCAGACACAAGTTCGGGAAATCCGGCCTCGACCTTC
GCCGACCAGATCAAGCGCGGTGTCTCGGACGGCATCATTGGCGAGCCACAGCTGGTGACGACGCTGCAGC
CGACGCCCGTCGAGACGCAGGAAGAGAAGCGAGCGGTCAATCCGTTCACACCGCAGCCTGGTCGAAGAGA
AGAGGCGCGGCCGGAAGCGCAACTGGAATCCGAACAAGTATGGCGGGCCCGTTTGCAGCGCGAGCAGGAA
GAGCAATATCTTCGCGAGCGGCAGCGCCAAAGAATGGCGCGGCTGCAGGCCAATGATGCCGCCTATGATT
CACCGATCGCTGTCGATCGCGACAAGTTCGCCGGTCGAGGAGCGGATACCGCCGCCATGGCCTCCGCGAC
GACGAATGGAGTTTCCACGGCGACGACATCGGGCGCGTCGGATCTATACGCCGCAGCTCTTCGCGCTGGT
CTCGGTGGACAGAATGGTGATCCGAACGGCCAGAAATCCAAGGAGGATTTCTTCAATGCCGACCTCAAGG
AGCTCGGCTACCTTCCCAACCGTGTCGTCCCCCAACAGTCGATTTACGAACTCAAGCGTGGCTCTGTTAT
CCCCGCGACATTGATTACCGGGATTAATTCCGACCTCCCCGGCCGGATCACCGCTCAGGTGAGCCAGAAC
GTCTACGATTCAGCGACGGGACATCGGCTGCTGATCCCGCAGGGAACGAAGCTGTTTGGCCGCTATGACA
GCAAGGTCTCGTTCGGCCAGAGCCGCGTCCTTGTCGTCTGGACGGACATCATCTTCCCGAACGGCTCGAC
GCTTCAGATCGGCGGCATGGCCGGGACGGACGCGCAGGGCTACAGCGGTTCCCGCGATAAGGTGGATCGG
AAGTGGCTCCAGACGTTTGGTTCGGCCATCCTTATTGCGGTGATCGGCACGGGGATCGACATGGCCGTGC
CTGAGAGTTCGACACTCGCGACGCAGGATACGGCATCAGATGCGGCGCGGAGGAATTTCGCAGAGACTTT
CGGGCGCGTCGCTGACCGGACCATCCAGAGAAACATGGACGTGCAGCCTACGCTCGAGATCCGGCCTGGT
TACAAATTCAACGTCCTGGTCGATCAGGACATTGTCTTCCCGGGGACGTATCGATGA
 Primer design