SecReT4
Protein ID: 10954828
T4SS name [ID]Trb [244]
Gene symboltiorf8
Locus tagpTi-SAKURA_p009
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]8637..9113 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ9R6N9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 9.4e-31, Aligned region: 49..155
Protein Sequence: 158 a.a.     [Download]
>gi|10954828|ref|NP_053248.1| hypothetical protein pTi-SAKURA_p009 [Agrobacterium tumefaciens]
MRSLLSHPQPSHAIRSLAAACALALFLSGCQSLGTDGLTASNAPAEISGPAASAIAGDMVGRLAEQIGPG
TATVSLKQDNSPFGQALEAALKGWGYAVVTDQKTDGVSRIVPLAYVVIPFEGQVLTRLSTNSIELGRAYT
VTTSGAQPASALAVMKRG
 
Nucleotide Sequence: 477 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c9113-8637 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGCGAAGCTTGCTCTCCCACCCACAGCCGTCGCACGCCATCCGCAGCCTTGCCGCAGCCTGCGCCCTCG
CCCTCTTCCTTTCCGGATGCCAGTCGCTCGGAACGGATGGACTGACCGCCAGCAACGCTCCGGCCGAGAT
ATCGGGACCGGCGGCGAGCGCCATCGCCGGTGACATGGTGGGCAGGCTCGCCGAGCAGATCGGCCCCGGC
ACGGCGACCGTCTCGCTGAAGCAGGACAACTCGCCCTTCGGGCAAGCGTTGGAAGCTGCCCTCAAGGGAT
GGGGCTACGCTGTCGTGACTGACCAGAAGACCGATGGCGTCTCGCGGATTGTACCCCTCGCCTATGTCGT
CATTCCCTTTGAGGGCCAGGTACTCACACGTCTGTCGACCAACAGTATCGAGCTCGGCCGTGCCTATACT
GTCACCACGAGTGGTGCGCAGCCGGCGAGCGCGCTCGCAGTCATGAAGCGCGGCTAG
 Primer design