SecReT4
Protein ID: 10954829
T4SS name [ID]Trb [244]
Gene symboltiorf9
Locus tagpTi-SAKURA_p010
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]9113..9967 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDO66177
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-60, Aligned region: 68..281
Protein Sequence: 284 a.a.     [Download]
>gi|10954829|ref|NP_053249.1| hypothetical protein pTi-SAKURA_p010 [Agrobacterium tumefaciens]
MNIQLRRFSATLTAATIVAVIVPFSASLSSRALAADGVTANEAKGMGISGQWRGSRGLVTKGPDGKVIFL
YGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPNLVTSMVVT
TSRRTYHIQLKSHANQYMARVGFEYPEDVSTRLADINARMEASTIPGAGVPAEQLNFSYSVSGSAGWRPT
RVYSDGEKTYVQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMVVDYNVDRAVLVSGVGWKQEKVTIR
RGGR
 
Nucleotide Sequence: 855 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c9967-9113 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGAACATTCAACTCAGACGTTTTTCGGCCACGCTGACTGCTGCAACGATCGTCGCCGTCATCGTGCCGT
TTTCGGCTTCTCTTTCCTCCCGCGCGCTCGCGGCCGATGGCGTCACAGCCAACGAAGCGAAGGGCATGGG
GATATCCGGACAGTGGCGCGGCAGTCGCGGCCTCGTGACGAAAGGACCGGACGGAAAGGTGATCTTCCTC
TATGGAGAAGTGCAGCCGTCCGTGGTCTGCTCGCCCTTGCAGGTTTGCGACATCGAGCTTCAGGGCGGCG
AGGTGGTCCGCGACGTGCTGGTCGGCGACACGGTTCGCTGGAAGGTCGAGCCTGCAACCTCGGGCGCTGC
CGGCGGGCAGGCGATCCACCTGATCGTCAAGCCGTCGGAGCCAAACCTCGTCACCTCTATGGTGGTGACG
ACCTCGCGGCGCACCTATCACATCCAGCTCAAGTCGCATGCAAACCAATATATGGCCCGCGTCGGCTTCG
AATATCCGGAAGACGTCTCGACCAGGCTCGCCGACATCAATGCTCGAATGGAGGCGAGCACCATTCCAGG
CGCCGGCGTTCCGGCCGAGCAGCTCAATTTTTCCTATTCCGTCTCAGGCAGCGCCGGCTGGCGGCCGACG
CGCGTCTATTCGGACGGGGAGAAGACCTACGTCCAGTTCCCGCGCTCGATCTCCGGCCAGGACGCGCCGG
TCCTCTTCGTGGTCTCCGGTGGGCAGAACCGCATCGTCAACTACCGGATGAAGGGAGATATGATGGTCGT
TGACTATAACGTCGACCGTGCGGTCCTCGTCTCCGGCGTCGGCTGGAAACAGGAGAAAGTGACGATCCGA
CGGGGAGGGCGGTGA
 Primer design