SecReT4
Protein ID: 10954830
T4SS name [ID]Trb [244]
Gene symboltiorf10
Locus tagpTi-SAKURA_p011
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]9985..10647 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDO66176
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-42, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|10954830|ref|NP_053250.1| hypothetical protein pTi-SAKURA_p011 [Agrobacterium tumefaciens]
MAGRTPPDNPYIAARTEWNERYGSYVKAAAAWRLVGVTGMIMAVIGFSYALYQSTQVKLVPYIVEVDKLG
TASNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYALLRTSDPATEKVNAWFRSSSP
FEKAKNATVAVEVNNIVALSNQSYQIDWTEFERDRRGKETATRRFRSIATVTLTPPQDEGVIRLNPIGLY
LRDLDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c10647-9985 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGGCCGGACGTACCCCGCCCGACAATCCCTATATTGCTGCGAGAACCGAATGGAATGAGCGCTATGGCT
CCTATGTGAAGGCGGCGGCAGCCTGGCGTCTGGTCGGCGTCACCGGGATGATCATGGCGGTGATCGGTTT
CAGCTACGCGCTCTACCAGAGCACGCAGGTCAAGCTGGTGCCGTATATCGTCGAGGTCGACAAGCTTGGG
ACTGCCTCCAACGCCGGCTTCCCTCAGCAGATCGAATATGCCGATCCGCGCGTGGTGCGCGCCACGCTTG
GCAGTTTCGTTTCGAACTTCCGGTCTGTTACGCCGGATGCGGTGGTGCAGAAGCAATATATCGACCGCAC
CTATGCGCTGCTTCGGACCTCGGATCCCGCGACCGAAAAGGTCAACGCCTGGTTCCGCTCCTCCTCGCCG
TTCGAGAAGGCGAAGAACGCGACCGTCGCCGTCGAGGTCAACAACATCGTCGCGCTGTCGAACCAGAGCT
ACCAGATCGACTGGACGGAGTTCGAGCGCGATCGCCGCGGCAAGGAGACCGCAACACGCCGGTTCCGCAG
CATCGCCACGGTAACACTCACGCCGCCGCAGGACGAGGGCGTCATCCGACTGAACCCGATCGGTCTCTAT
CTCCGGGATCTCGACTGGACCGCGCAGCTTTGA
 Primer design