SecReT4
Protein ID: 10954831
T4SS name [ID]Trb [244]
Gene symboltiorf11
Locus tagpTi-SAKURA_p012
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]10662..11825 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ9R6N8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.7e-30, Aligned region: 56..268
Protein Sequence: 387 a.a.     [Download]
>gi|10954831|ref|NP_053251.1| hypothetical protein pTi-SAKURA_p012 [Agrobacterium tumefaciens]
MTFIVMAIVLLATAPAFAQQGTVLTTLENQVVTAAKGWETTILNAARSLFWILAGIEIGIAAVWLAINAA
SLDAWFAELVRRIMFIGLFAFILERGPALAKAVVDSLFQIGAGGGSASPANIFDAGIRVASKMSEQAKFG
LFEDNALAIAAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFAVRYLVYAFSVG
MKLMALVMIAKIGSDILIGLAEAPTATSDQFITTLAIAGISVVVFVIAMYVPPIIQGVVQGASVSGGMEA
IRHGGQTAAFAAGGAFLGAGAAMKGAQSASTARAEGSSMAGAALRGMASGIGNAGWAAGSAAKEKAIASP
GAYAGSLLGLANAKLDQTRQSGRPSAPPPPPPVNENK
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c11825-10662 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGACCTTCATCGTGATGGCAATCGTACTGCTTGCGACCGCGCCGGCCTTCGCCCAGCAAGGCACGGTCC
TGACCACATTGGAAAACCAGGTGGTCACCGCCGCCAAGGGCTGGGAGACGACGATCCTGAACGCGGCCCG
ATCGTTGTTCTGGATCCTCGCCGGAATCGAGATCGGCATCGCCGCCGTCTGGCTCGCAATCAACGCCGCG
TCGCTTGATGCCTGGTTCGCCGAGCTTGTCCGCCGCATCATGTTCATCGGCCTTTTCGCCTTTATCCTCG
AGCGCGGCCCGGCGTTGGCGAAGGCGGTGGTCGACAGCCTGTTCCAGATCGGCGCCGGTGGCGGCTCGGC
CTCGCCCGCCAACATCTTCGATGCTGGCATCCGCGTCGCCTCGAAAATGTCCGAGCAGGCGAAGTTCGGC
CTGTTCGAGGACAACGCGCTCGCCATCGCGGCGGTCTTTGCGATGGTCGTGGTCGTCGTCTCCTTCTCAT
TGGTGGCCGCAATCTTTGTGGCGGTCATGGTGGAGATGTATGTCGGGCTTCTGGCAGGAATGATCATGCT
CGGGCTGGGTGGCTCGTCCTACACCAAGGATTTTGCGGTCCGGTATCTCGTCTACGCCTTCTCGGTCGGC
ATGAAGCTGATGGCTCTGGTGATGATCGCCAAGATCGGTTCGGACATCCTGATCGGACTGGCCGAGGCGC
CGACGGCAACCTCCGACCAGTTTATCACGACACTTGCCATCGCCGGCATATCGGTCGTCGTGTTCGTCAT
CGCCATGTACGTGCCGCCGATCATCCAGGGCGTCGTCCAGGGTGCATCGGTCTCGGGCGGCATGGAGGCA
ATCCGCCACGGTGGTCAGACGGCCGCCTTCGCCGCCGGCGGCGCTTTCCTTGGCGCAGGCGCCGCGATGA
AAGGGGCGCAATCGGCAAGTACGGCGAGGGCTGAGGGCTCATCGATGGCCGGGGCGGCGCTCCGTGGCAT
GGCGTCCGGCATCGGCAACGCCGGATGGGCGGCGGGCTCGGCAGCAAAGGAGAAGGCGATTGCCTCGCCC
GGTGCCTATGCCGGCTCGCTGCTCGGTCTCGCCAACGCCAAGCTCGACCAGACGCGGCAATCCGGCAGGC
CCTCGGCGCCTCCTCCGCCTCCACCCGTCAACGAAAACAAATAA
 Primer design