SecReT4
Protein ID: 10954832
T4SS name [ID]Trb [244]
Gene symboltiorf12
Locus tagpTi-SAKURA_p013
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]11852..12070 [-]
Producthypothetical protein
Component typeTrbK
UniProt IDO66174
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2749 [PF10907], Evalue: 1.8e-29, Aligned region: 1..72
Protein Sequence: 72 a.a.     [Download]
>gi|10954832|ref|NP_053252.1| hypothetical protein pTi-SAKURA_p013 [Agrobacterium tumefaciens]
MSPRILIALAVAGLVAIAGGTILWVVVQPDAAIETPTGTSGSGEARREQRDRFFGGDPDRDVRGGQEMKP
RW
 
Nucleotide Sequence: 219 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c12070-11852 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
GTGAGCCCGCGCATCCTCATCGCCCTTGCCGTAGCCGGCCTCGTCGCGATCGCGGGCGGCACGATCCTCT
GGGTGGTCGTCCAGCCGGATGCTGCGATTGAAACACCAACCGGGACGTCGGGCTCGGGAGAGGCGCGACG
CGAGCAACGGGACCGCTTCTTCGGCGGCGATCCGGATCGCGACGTGCGCGGCGGGCAGGAGATGAAGCCA
CGATGGTAG
 Primer design