SecReT4
Protein ID: 10954833
T4SS name [ID]Trb [244]
Gene symboltiorf13
Locus tagpTi-SAKURA_p014
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]12067..12870 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDO66173
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2749 [PF10907], Evalue: 2.8e-05, Aligned region: 243..267
Protein Sequence: 267 a.a.     [Download]
>gi|10954833|ref|NP_053253.1| hypothetical protein pTi-SAKURA_p014 [Agrobacterium tumefaciens]
MPRHFSRPLEAARVAMITAIVILVAFPTYAGGVTGQATEWTQLANNAELISLVGKSAEQVNNQITQISQL
AEQIQNQINIYKNLLQNTAQLPNHIWGQVENDLSKLQNIVAQGQGVAFSMGNIDDVLKQRFQSFADMKTN
LPDGQSFSSTYQGWSDTNRDTIAGTLKAANLTAEQFSSEESTMSSLRSLSESADGQMKALQVGHQIATQQ
VAQMQKLRGLVSQQMTMMGTWFQSEQAQKDLAQARREQFFNAPTNDIRGGQTMEPRW
 
Nucleotide Sequence: 804 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c12870-12067 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGCCGAGACACTTTTCCCGGCCGCTTGAAGCGGCGCGCGTTGCTATGATCACGGCCATCGTTATCCTGG
TCGCTTTCCCAACATATGCTGGCGGCGTCACCGGTCAGGCGACCGAATGGACGCAGCTTGCCAACAATGC
CGAGCTTATCAGCCTCGTCGGCAAGTCGGCCGAGCAGGTGAATAACCAGATCACGCAGATCAGCCAGCTT
GCGGAGCAGATCCAGAACCAGATCAACATCTACAAGAACCTGCTGCAAAACACCGCGCAGCTACCGAACC
ACATCTGGGGTCAGGTCGAGAATGACCTCAGCAAGCTGCAGAATATCGTCGCGCAGGGGCAGGGCGTCGC
ATTCTCGATGGGCAATATCGACGACGTCCTGAAGCAACGCTTCCAGAGCTTCGCAGACATGAAGACCAAC
TTGCCCGACGGCCAGAGCTTCTCGTCGACCTATCAAGGCTGGTCAGACACCAATCGCGACACGATCGCCG
GCACGTTGAAGGCGGCGAATCTGACAGCCGAGCAGTTTTCCAGCGAGGAATCCACCATGTCCTCGCTGCG
CTCTCTGTCGGAGAGCGCCGACGGCCAGATGAAGGCCCTGCAGGTCGGGCATCAGATCGCCACGCAGCAG
GTGGCGCAGATGCAAAAGCTGCGCGGGCTCGTCTCGCAGCAGATGACGATGATGGGCACATGGTTCCAGT
CCGAGCAGGCACAGAAGGATCTGGCCCAGGCCCGGCGTGAACAGTTCTTCAACGCGCCGACCAATGACAT
CCGCGGCGGCCAGACGATGGAGCCGCGCTGGTGA
 Primer design