SecReT4
Protein ID: 10954834
T4SS name [ID]Trb [244]
Gene symboltiorf14
Locus tagpTi-SAKURA_p015
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]12842..15310 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDO66172
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.6e-52, Aligned region: 193..400
AAA_10 [PF12846], Evalue: 1.5e-33, Aligned region: 457..733
Protein Sequence: 822 a.a.     [Download]
>gi|10954834|ref|NP_053254.1| hypothetical protein pTi-SAKURA_p015 [Agrobacterium tumefaciens]
MVALKQFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNEVSRQINMILSRLG
SGWMIQVEALRVPTIDYPAEDACHFPDPVTRAIDAERRSHFERESGHFESRHALILTWRPPEPRRSGLTR
YVYADAGSRSATYADTALDSFRTSIREVEQYLANVVSIRRMMTQETQERGGFRRARYDELFQFIRFCITG
ENHPIRLPDIPMYLDWLVTAELQHGLTPTIENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFVF
LDEQEARSRLERTRKKWQQKVRPFFDQLFQTQSRSVDQDAMMMVAETEDAIAQAASQLVAYGYYTPAIIL
FDEVQPRLQEKCEAIRRLIQAEGFGARIETLNATDAFLGSLPGVSYANIREPLVNTRNLADLIPLNSVWS
GNPVAPCPFYPAGSPPLMQVASGSTPFRLSLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQIFA
FDKGRSMLPLTLAIGGDHYEIDGDAAGEGEGASPRPAFCPLAELSTDGDRAWAAEWIETLVALQGVTVTP
DYRNAISRQLVLMAESRGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLALGAFQCFEVEEL
MNMGERNLVPVLLYMFRRVEKRLTGAPSLIIIDEAWLMLGHPTFRDKIREWLKVLRKANCAVVLATQSIS
DAERSGIIDVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVATAMPKREYYVASPEGRRLFDM
SLGPVALSFVGASGKEDLKSIRALHSENGADWPIHWLQQRGIAHAETLFPAA
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c15310-12842 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGGTGGCACTGAAACAGTTCCGACACTCCGGCCCGTCCTTCGCCGACCTGGTTCCCTATGCTGGACTGG
TCGACAACGGCGTGATCCTGCTGAAGGACGGCTCGCTGATGGCTGGCTGGTATTTTGCCGGGCCGGACAG
CGAAAGTTCGACCGACGCCGAGCGCAATGAGGTCAGCCGGCAGATCAATATGATCCTCTCCCGGCTGGGC
TCGGGCTGGATGATACAGGTCGAAGCGTTGCGCGTCCCGACGATCGACTATCCGGCAGAGGACGCCTGCC
ATTTCCCCGATCCGGTGACGCGTGCGATTGACGCCGAGCGCAGATCTCATTTTGAGAGGGAGAGCGGACA
TTTCGAGAGCCGACACGCCCTGATCCTGACCTGGCGGCCCCCCGAGCCAAGGCGATCGGGGCTGACGCGC
TACGTCTATGCCGATGCAGGGAGCCGTTCTGCCACCTACGCGGATACGGCGCTCGATTCCTTCCGCACTT
CGATCCGCGAAGTGGAGCAATATCTTGCCAATGTCGTCTCCATACGCCGCATGATGACCCAGGAGACGCA
AGAGCGTGGCGGTTTCCGCCGCGCGCGCTACGACGAGCTGTTCCAGTTCATTCGCTTCTGCATCACTGGC
GAGAACCACCCCATCCGCCTGCCGGATATCCCGATGTATCTCGATTGGCTGGTCACCGCTGAGCTCCAGC
ACGGCCTGACGCCGACCATCGAGAACCGTTTCCTCGGTGTCGTCGCCATCGACGGCCTGCCGGCGGAGAG
TTGGCCGGGAATCCTGAACAGCCTCGACCTGATGCCGCTCACCTATCGATGGTCGTCGCGCTTTGTCTTT
CTCGATGAGCAGGAGGCACGCTCGAGGCTGGAGCGCACCCGCAAGAAGTGGCAGCAGAAGGTTAGGCCGT
TTTTCGACCAGCTTTTCCAGACGCAGAGCCGCTCGGTCGATCAGGACGCCATGATGATGGTGGCCGAGAC
CGAGGATGCAATCGCTCAAGCCGCCTCGCAGCTCGTCGCCTACGGCTACTACACGCCGGCCATCATCCTG
TTCGACGAAGTCCAGCCACGCCTTCAGGAAAAGTGCGAGGCGATCCGCCGCCTGATCCAGGCCGAGGGCT
TTGGCGCCCGGATCGAAACTCTCAACGCAACCGACGCTTTTCTCGGCAGCCTGCCGGGCGTTTCCTATGC
CAACATCCGCGAGCCGCTGGTCAATACCCGCAATCTCGCCGACCTCATCCCGCTGAACTCGGTCTGGTCC
GGAAACCCGGTCGCACCGTGCCCGTTCTATCCGGCCGGCTCACCGCCACTCATGCAGGTCGCCAGCGGAT
CGACGCCATTCCGCCTTAGCCTCCACGTCGACGATGTTGGCCACACGCTCGTCTTCGGTCCGACGGGTTC
TGGAAAGTCCACCCTGCTGGCGCTGATCGCCGCACAGTTTCGCCGCTATGCCGGCGCGCAGATCTTCGCC
TTTGACAAGGGCCGCTCCATGCTGCCGCTGACGCTCGCCATCGGCGGCGATCACTACGAGATCGACGGCG
ACGCGGCCGGAGAAGGGGAGGGAGCATCGCCACGACCGGCCTTCTGCCCGCTCGCCGAACTCTCGACCGA
TGGCGACCGCGCCTGGGCAGCCGAGTGGATCGAGACACTTGTCGCGCTGCAGGGCGTCACTGTCACGCCT
GACTATCGCAACGCCATTTCCAGACAGTTGGTCTTGATGGCGGAATCGCGCGGCCGCTCGCTCTCGGACT
TCGTCTCCGGGGTGCAGATGCGCGAGATAAAAGACGCGCTGCACCACTACACCGTCGATGGGCCGATGGG
TCAGTTGCTCGATGCCGAAGAGGACGGACTGGCGCTCGGCGCCTTCCAGTGCTTCGAGGTCGAGGAGCTG
ATGAACATGGGCGAGCGCAACCTCGTACCGGTCTTGCTCTATATGTTCCGGCGTGTCGAGAAGCGTCTGA
CCGGCGCTCCAAGCCTGATCATCATCGACGAAGCCTGGCTGATGCTCGGTCATCCGACCTTCCGCGACAA
GATCCGCGAATGGTTGAAGGTCCTGCGAAAAGCCAATTGCGCCGTGGTGCTCGCCACGCAGTCGATCTCT
GATGCCGAGCGGTCCGGCATCATCGATGTGCTGAAGGAATCCTGCCCGACCAAGATCTGCCTGCCCAACG
GCGCGGCACGCGAACCAGGGACACGCGAGTTTTATGAGCGGATCGGCTTCAACGAGCGGCAGATCGAGAT
CGTCGCAACCGCCATGCCGAAGCGCGAATATTACGTCGCCTCGCCGGAGGGTCGCAGGCTCTTCGATATG
TCGCTCGGTCCCGTGGCGCTCTCCTTCGTCGGTGCGTCCGGCAAGGAGGATCTGAAGAGCATCCGCGCCC
TTCATTCTGAAAACGGGGCGGATTGGCCCATTCACTGGCTCCAGCAAAGGGGGATCGCCCATGCCGAGAC
ACTTTTCCCGGCCGCTTGA
 Primer design