SecReT4
Protein ID: 10954835
T4SS name [ID]Trb [244]
Gene symboltiorf15
Locus tagpTi-SAKURA_p016
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]15321..15620 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDO66171
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.4e-28, Aligned region: 1..91
Protein Sequence: 99 a.a.     [Download]
>gi|10954835|ref|NP_053255.1| hypothetical protein pTi-SAKURA_p016 [Agrobacterium tumefaciens]
MAEPGSNLARSRVHRALSRPNLLMGADRELVLLTGLAAVILIFVVLTWYAALFGVAIWLVAVAALRMMAK
SDPLMRRVYLRHVSYRSHYRPTSTPWRKF
 
Nucleotide Sequence: 300 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c15620-15321 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGGCTGAGCCGGGTTCCAACCTTGCGCGTTCTCGGGTCCACCGGGCGCTGTCGCGCCCGAACCTGCTGA
TGGGCGCCGACCGCGAGCTGGTATTGCTCACCGGGCTTGCCGCCGTGATCCTGATCTTCGTCGTGCTGAC
GTGGTACGCCGCATTGTTCGGCGTCGCGATCTGGCTCGTTGCGGTCGCGGCCCTTCGCATGATGGCGAAA
TCCGACCCGCTGATGCGCCGCGTTTATCTGCGGCATGTCTCCTATCGGTCCCACTATCGGCCGACCTCGA
CGCCCTGGCGCAAGTTTTGA
 Primer design